REI Gene Information


Name : BJAB0715_00999 (BJAB0715_00999)
Accession : YP_008216147.1
REI name : AbaR27
REI accession : NC_021733_R1
Strain : Acinetobacter baumannii 1656-2
Resistance or Virulence: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   2 hits    ( 2 protein-level )  
Publication :
    -Xuan,Z., Zhu,L., Shen,D., Yan,Z., Zhang,Z., Fang,X., Zhou,J. and Li,Q.Zhen., "Direct Submission", Submitted (18-OCT-2012) Molecular and Cell Biology, University of Texas at Dallas, 800 W Campbell Road, Richardson, TX 75080, USA.

    -Zhu,L., Yan,Z., Zhang,Z., Zhou,Q., Zhou,J., Wakeland,E.K., Fang,X., Xuan,Z., Shen,D. and Li,Q.Z., "Complete Genome Analysis of Three Acinetobacter baumannii Clinical Isolates in China for Insight into the Diversification of Drug Resistance Elements", PLoS ONE 8 (6), E66584 (2013) PUBMED 23826102 REMARK Publication Status: Online-Only.

    -Zhu,L., Yan,Z., Zhang,Z., Zhou,Q., Zhou,J., Wakeland,E.K., Fang,X., Xuan,Z., Shen,D. and Li,Q.Z., "Direct Submission", Submitted (10-JUL-2013) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGACAGGCTTATCTTTTTTATTAACTAAAATGATTGAAGAAATGTATCTTTCAGTGGATGAGAAATCACTACGAAGTGT
AAAAGTTGCTGCAATACTATTTCCAGACTTTCTTAAATAA

Protein sequence :
MTGLSFLLTKMIEEMYLSVDEKSLRSVKVAAILFPDFLK