REI Gene Information


Name : ABZJ_00235 (ABZJ_00235)
Accession : YP_005524191.1
REI name : AbaR22
REI accession : NC_017171_R1
Strain : Acinetobacter baumannii 1656-2
Resistance or Virulence: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   8 hits    ( 8 protein-level )  
Publication :
    -Zhang,T. and Yu,D., "Direct Submission", Submitted (01-FEB-2010) Key Laboratory of Diagnosis and Treatment for Infectious Disease, The 1st Affiliated Hospital of School of Medicine, Zhejiang University, 79 Qingchun Road, Hangzhou, Zhejiang 310003, China.

    -Zhou,H., Zhang,T., Yu,D., Pi,B., Yang,Q., Zhou,J., Hu,S. and Yu,Y., "Genomic Analysis of the Multidrug-Resistant Acinetobacter baumannii Strain MDR-ZJ06 Widely Spread in China", Antimicrob. Agents Chemother. 55 (10), 4506-4512 (2011) PUBMED 21788470.

    -Zhou,H., Zhang,T., Yu,D., Pi,B., Yang,Q., Zhou,J., Hu,S. and Yu,Y., "Direct Submission", Submitted (05-APR-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
TTGATTTTCATCTTTATGAGTTTAAAACTTTATTGTGTAAACACAGCATTTAAAGCTTCATTAGGTGACTTTTTAGGTGG
TGGTGATAACTTAATTAACACATGGAAATCTACTCTATAA

Protein sequence :
MIFIFMSLKLYCVNTAFKASLGDFLGGGDNLINTWKSTL