PAI Gene Information


Name : SAB1885c (SAB1885c)
Accession : YP_417347.1
PAI name : SaPIbov2
PAI accession : NC_007622_P2
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   13 hits    ( 13 protein-level )  
Publication :
    -Herron-Olson,L., Fitzgerald,J.R., Musser,J.M. and Kapur,V., "Molecular correlates of host specialization in Staphylococcus aureus", PLoS ONE 2 (10), E1120 (2007) PUBMED 17971880 REMARK Publication Status: Online-Only.

    -Herron-Olson,L., Fitzgerald,J.R., Musser,J.M. and Kapur,V., "Direct Submission", Submitted (26-NOV-2005) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Herron-Olson,L.L., "Direct Submission", Submitted (05-APR-2005) Herron-Olson L.L., Biomedical Genomics Center, University of Minnesota, 1500 Gortner Ave, St. Paul, MN, 55417, USA.


DNA sequence :
ATGGCTACAATAAGTATTACTACAGATTATAAATTCACAAAAAAATCAGCGCAAAAACTAATAGATGCAATGGAGATTAA
CGAAAATAATAGTAATGTGAACAAAACAAACATAAAAGCGACTAAAATAAAATCAACTTGTGAGATTGAAAATCTATTGA
AGGACTATCGAAGTAATTGA

Protein sequence :
MATISITTDYKFTKKSAQKLIDAMEINENNSNVNKTNIKATKIKSTCEIENLLKDYRSN