PAI Gene Information


Name : M5005_Spy_0143 (M5005_Spy_0143)
Accession : YP_281507.1
PAI name : Not named
PAI accession : NC_007297_P1
Strain : Streptococcus pyogenes A20
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   5 hits    ( 5 protein-level )  
Publication :
    -Porcella,S.F., "Direct Submission", Submitted (20-AUG-2004) Laboratory of Human Bacterial Pathogenesis, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Disease, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA.

    -Sumby,P., Porcella,S.F., Madrigal,A.G., Barbian,K.D., Virtaneva,K., Ricklefs,S.M., Sturdevant,D.E., Graham,M.R., Vuopio-Varkila,J., Hoe,N.P. and Musser,J.M., "Evolutionary origin and emergence of a highly successful clone of serotype M1 group a Streptococcus involved multiple horizontal gene transfer events", J. Infect. Dis. 192 (5), 771-782 (2005) PUBMED 16088826.

    -Sumby,P., Porcella,S.F., Madrigal,A.G., Barbian,K.D., Virtaneva,K., Ricklefs,S.M., Sturdevant,D.E., Graham,M.R., Vuopio-Varkila,J., Hoe,N.P. and Musser,J.M., "Direct Submission", Submitted (08-AUG-2005) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGAAAAAGAAATTATCTTTATTTATGATCGCAACTGCTGCTGTCGTAAGCCTTAGCCTTGCAACACCAGAAAACCAAAC
TGTTTCAGCAAATGACACGCAAGTTACTTGTGTAGGATGTCCAGATTGTGGTCCAAAATGGTCTTGTTGTCCATTGACCT
GTATGCGCGATTTGTTAAGAGGTTGGGGCAAGTCAGCAGCATATTATTGCACTTGGGGATATTACTACTCTGAGTAA

Protein sequence :
MKKKLSLFMIATAAVVSLSLATPENQTVSANDTQVTCVGCPDCGPKWSCCPLTCMRDLLRGWGKSAAYYCTWGYYYSE