PAI Gene Information


Name : SERP2213 (SERP2213)
Accession : YP_189769.1
PAI name : vSe1
PAI accession : NC_002976_P3
Strain : Staphylococcus epidermidis ATCC 12228
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Gill,S.R., "Direct Submission", Submitted (20-OCT-2004) The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD 20850, USA.

    -Gill,S.R., "Direct Submission", Submitted (08-APR-2002) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Gill,S.R., Fouts,D.E., Archer,G.L., Mongodin,E.F., Deboy,R.T., Ravel,J., Paulsen,I.T., Kolonay,J.F., Brinkac,L., Beanan,M., Dodson,R.J., Daugherty,S.C., Madupu,R., Angiuoli,S.V., Durkin,A.S., Haft,D.H., Vamathevan,J., Khouri,H., Utterback,T., Lee,C., Dimi, "Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain", J. Bacteriol. 187 (7), 2426-2438 (2005) PUBMED 15774886.


DNA sequence :
ATGGAAAAGGTTAAATCATATTTAAAAGACATTCAAAACAACGAAAAGTATCAAAAAGATATAGAATTTCTTGAAAAGAA
AAGTAATGGAAGGGAAGACAGAAAATTTATATTAGATATATTCTTTTTATAG

Protein sequence :
MEKVKSYLKDIQNNEKYQKDIEFLEKKSNGREDRKFILDIFFL