PAI Gene Information


Name : YPTB1587 (YPTB1587)
Accession : YP_070115.1
PAI name : HPI
PAI accession : NC_006155_P1
Strain : Yersinia pseudotuberculosis IP 31758
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   42 hits    ( 42 protein-level )  
Publication :
    -Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O., Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L., Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C., Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D., El, "Insights into the evolution of Yersinia pestis through whole-genome comparison with Yersinia pseudotuberculosis", Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004) PUBMED 15358858.

    -Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O., Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L., Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C., Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D., El, "Direct Submission", Submitted (30-AUG-2004) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W., "Direct Submission", Submitted (08-FEB-2004) Biology and Biotechnology Research Program, Lawrence Livermore National Laboratory, Livermore, CA 94550 USA, Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15, France, and the Genome Analysis Group, Oak Ridge National.

    -Rosso,M.L., Chauvaux,S., Dessein,R., Laurans,C., Frangeul,L., Lacroix,C., Schiavo,A., Dillies,M.A., Foulon,J., Coppee,J.Y., Medigue,C., Carniel,E., Simonet,M. and Marceau,M., "Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression", BMC Microbiol. 8, 211 (2008) PUBMED 19055764 REMARK Publication Status: Online-Only.


DNA sequence :
GTGCCAGATGAAATCGATCGCGATCAGGCGTTTAATGAACGGTGCCTAGAAGCACTGATTGAACAAAGCCGGTTAAGACC
CACACCGACACCTTCCCTGCAGCACTGTCGATTTTGCGGCAAGGCTATTCCGGAAAAACGCCGTCAGACGCTGCCGGGTG
TAACAACCTGTACTGACTGTCAGTCGATACTGGAGAAACGCAGACGTTAA

Protein sequence :
MPDEIDRDQAFNERCLEALIEQSRLRPTPTPSLQHCRFCGKAIPEKRRQTLPGVTTCTDCQSILEKRRR