PAI Gene Information


Name : SAS0409 (SAS0409)
Accession : YP_042535.1
PAI name : vSa_alpha
PAI accession : NC_002953_P1
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : Ortholog of S. aureus MRSA252 (BX571856) SAR0451
Homologs in the searched genomes :   13 hits    ( 13 protein-level )  
Publication :
    -Holden,M.T.G., "Direct Submission", Submitted (23-JUN-2004) Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail: mh3@sanger.ac.uk.

    -Holden,M.T.G., Feil,E.J., Lindsay,J.A., Peacock,S.J., Day,N.P.J., Enright,M.C., Foster,T.J., Moore,C.E., Hurst,L., Atkin,R., Barron,A., Bason,N., Bentley,S.D., Chillingworth,C., Chillingworth,T., Churcher,C., Clark,L., Corton,C., Cronin,A., Doggett,J., Do, "Complete genomes of two clinical Staphylococcus aureus strains: Evidence for the rapid evolution of virulence and drug resistance", Proc. Natl. Acad. Sci. U.S.A. 101 (26), 9786-9791 (2004) PUBMED 15213324.

    -Holden,M.T.G., Feil,E.J., Lindsay,J.A., Peacock,S.J., Day,N.P.J., Enright,M.C., Foster,T.J., Moore,C.E., Hurst,L., Atkin,R., Barron,A., Bason,N., Bentley,S.D., Chillingworth,C., Chillingworth,T., Churcher,C., Clark,L., Corton,C., Cronin,A., Doggett,J., Do, "Direct Submission", Submitted (11-SEP-2004) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGAGTGAAGTAAATGCAGCTATCAATGTACTATTAACACTTACGGTCACACGAGTGTTTCAGTCTAAACGTGCAACGCA
ATTCTGCACGTGGCCAATATATCTTGGGATAGATTATGAAAATCATTAA

Protein sequence :
MSEVNAAINVLLTLTVTRVFQSKRATQFCTWPIYLGIDYENH