PAI Gene Information


Name : SAKOR_01922 (SAKOR_01922)
Accession : YP_008492110.1
PAI name : phi_Sa3
PAI accession : NC_022226_P4
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   2 hits    ( 2 protein-level )  
Publication :
    -Chen,Y., Chatterjee,S.S., Porcella,S.F., Yu,Y.S. and Otto,M., "Complete Genome Sequence of a Panton-Valentine Leukocidin-Negative Community-Associated Methicillin-Resistant Staphylococcus aureus Strain of Sequence type 72 from Korea", PLoS ONE 8 (8), E72803 (2013) PUBMED 23977354 REMARK Publication Status: Online-Only.

    -Chen,Y., Chatterjee,S.S., Porcella,S.F., Yu,Y.S. and Otto,M., "Direct Submission", Submitted (30-AUG-2013) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Otto,M. and Porcella,S.F., "Direct Submission", Submitted (04-DEC-2012) Laboratory of Human Bacterial Pathogenesis, NIAID/NIH, 9000 Rockville Pike, Bethesda, MD 20892, USA.


DNA sequence : 
ATGCGGTGTAGCGACTGTAATATTTCTATGTTGTTGAGATATATGTATCGAGTGAAGGGCAAAAAGGATATCAATTGCAG
GATAAGTGTTAGGTTACTAGGCCACTTAACAGGCTATATAGTTCACTCCTACTATATACAGTTAATTATAACATAA

Protein sequence : 
MRCSDCNISMLLRYMYRVKGKKDINCRISVRLLGHLTGYIVHSYYIQLIIT