PAI Gene Information


Name : CpC231_0179 (CpC231_0179)
Accession : YP_005682542.1
PAI name : PiCp 3
PAI accession : NC_017301_P3
Strain : Corynebacterium pseudotuberculosis 1/06-A
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   8 hits    ( 8 protein-level )  
Publication :
    -Ruiz,J., Silva,A., D'Afonseca,V., Pinto,A., Santos,A., Soares,S., Almeida,S., Resende,D., Dorella,F., Pacheco,L., Moraes,P., Seyffert,N., Castro,T., Miyoshi,A., Moore,R. and Azevedo,V., "Direct Submission", Submitted (26-OCT-2009) General Biology, Federal University of Minas Gerais, Av. Antonio Carlos, 6627 - Pampulha, Belo Horizonte, Minas Gerais 31270-901, Brazil.

    -Ruiz,J.C., D'Afonseca,V., Silva,A., Ali,A., Pinto,A.C., Santos,A.R., Rocha,A.A., Lopes,D.O., Dorella,F.A., Pacheco,L.G., Costa,M.P., Turk,M.Z., Seyffert,N., Moraes,P.M., Soares,S.C., Almeida,S.S., Castro,T.L., Abreu,V.A., Trost,E., Baumbach,J., Tauch,A., , "Evidence for reductive genome evolution and lateral acquisition of virulence functions in two Corynebacterium pseudotuberculosis strains", PLoS ONE 6 (4), E18551 (2011) PUBMED 21533164 REMARK Publication Status: Online-Only.

    -Ruiz,J.C., D'Afonseca,V., Silva,A., Ali,A., Pinto,A.C., Santos,A.R., Rocha,A.A., Lopes,D.O., Dorella,F.A., Pacheco,L.G., Costa,M.P., Turk,M.Z., Seyffert,N., Moraes,P.M., Soares,S.C., Almeida,S.S., Castro,T.L., Abreu,V.A., Trost,E., Baumbach,J., Tauch,A., , "Direct Submission", Submitted (05-APR-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Ruiz,J.C., D'Afonseca,V., Silva,A., Ali,A., Pinto,A.C., Santos,A.R., Rocha,A.A., Lopes,D.O., Dorella,F.A., Pacheco,L.G., Costa,M.P., Turk,M.Z., Seyffert,N., Moraes,P.M., Soares,S.C., Almeida,S.S., Castro,T.L., Abreu,V.A., Trost,E., Baumbach,J., Tauch,A., , "Direct Submission", Submitted (18-JUL-2011) Department of General Biology, Federal University of Minas Gerais, Av. Antonio Carlos, 6627 - Pampulha, Belo Horizonte, Minas Gerais 31270-901, Brazil REMARK Protein update by submitter.

    -Silva,A., Schneider,M.P., Cerdeira,L., Barbosa,M.S., Ramos,R.T., Carneiro,A.R., Santos,R., Lima,M., D'Afonseca,V., Almeida,S.S., Santos,A.R., Soares,S.C., Pinto,A.C., Ali,A., Dorella,F.A., Rocha,F., de Abreu,V.A., Trost,E., Tauch,A., Shpigel,N., Miyoshi,A, "Complete Genome Sequence of Corynebacterium pseudotuberculosis I19, a Strain Isolated from a Cow in Israel with Bovine Mastitis", J. Bacteriol. 193 (1), 323-324 (2011) PUBMED 21037006.


DNA sequence :
ATGTCAATAGTTGATATGCGGAAAACGCAGCCGTTAGATTCTCAAATCTATTATATAAATATGTCTTTTGATCAGCTCAT
GGGGTATGTCCGTGAATACATAGACGGCCTTGATGATCAATTTCCAGCGACTTTATTTGAAGTGGGTAGGGGGGACGTGA
GAAATGGCTACATCTACAGCGCGGCTGGGAATACGGGAATGTCTTAA

Protein sequence :
MSIVDMRKTQPLDSQIYYINMSFDQLMGYVREYIDGLDDQFPATLFEVGRGDVRNGYIYSAAGNTGMS