PAI Gene Information


Name : Cp1002_0024 (Cp1002_0024)
Accession : YP_005680303.1
PAI name : PiCp 1
PAI accession : NC_017300_P1
Strain : Corynebacterium pseudotuberculosis 1/06-A
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   6 hits    ( 6 protein-level )  
Publication :
    -Ruiz,J.C., D'Afonseca,V., Silva,A., Ali,A., Pinto,A.C., Santos,A.R., Rocha,A.A., Lopes,D.O., Dorella,F.A., Pacheco,L.G., Costa,M.P., Turk,M.Z., Seyffert,N., Moraes,P.M., Soares,S.C., Almeida,S.S., Castro,T.L., Abreu,V.A., Trost,E., Baumbach,J., Tauch,A., , "Evidence for reductive genome evolution and lateral acquisition of virulence functions in two Corynebacterium pseudotuberculosis strains", PLoS ONE 6 (4), E18551 (2011) PUBMED 21533164 REMARK Publication Status: Online-Only.

    -Ruiz,J.C., D'Afonseca,V., Silva,A., Ali,A., Pinto,A.C., Santos,A.R., Rocha,A.A., Lopes,D.O., Dorella,F.A., Pacheco,L.G., Costa,M.P., Turk,M.Z., Seyffert,N., Moraes,P.M., Soares,S.C., Almeida,S.S., Castro,T.L., Abreu,V.A., Trost,E., Baumbach,J., Tauch,A., , "Direct Submission", Submitted (05-APR-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Ruiz,J.C., D'Afonseca,V., Silva,A., Ali,A., Pinto,A.C., Santos,A.R., Rocha,A.A., Lopes,D.O., Dorella,F.A., Pacheco,L.G., Costa,M.P., Turk,M.Z., Seyffert,N., Moraes,P.M., Soares,S.C., Almeida,S.S., Castro,T.L., Abreu,V.A., Trost,E., Baumbach,J., Tauch,A., , "Direct Submission", Submitted (18-JUL-2011) General Biology, Federal University of Minas Gerais, Av. Antonio Carlos, 6627 - Pampulha, Belo Horizonte, Minas Gerais 31270-901, Brazil REMARK Sequence update by submitter.

    -Ruiz,J.C., Silva,A., D'Afonseca,V., Pinto,A.C., dos Santos,A.R., de Almeida,S.S., Soares,S., Resende,D., Costa,M., Dorella,F.A., Pacheco,L.G., Seyffert,N., Castro,T.L., Moraes,P.M., Pedrosa,A.L., Vieira,C.U., Guimaraes,C.T., Santos,F., Lobo,F.P., Franco,G, "Direct Submission", Submitted (06-OCT-2009) General Biology, Federal University of Minas Gerais, Av. Antonio Carlos, 6627 - Pampulha, Belo Horizonte, Minas Gerais 31270-901, Brazil.

    -Silva,A., Schneider,M.P., Cerdeira,L., Barbosa,M.S., Ramos,R.T., Carneiro,A.R., Santos,R., Lima,M., D'Afonseca,V., Almeida,S.S., Santos,A.R., Soares,S.C., Pinto,A.C., Ali,A., Dorella,F.A., Rocha,F., de Abreu,V.A., Trost,E., Tauch,A., Shpigel,N., Miyoshi,A, "Complete Genome Sequence of Corynebacterium pseudotuberculosis I19, a Strain Isolated from a Cow in Israel with Bovine Mastitis", J. Bacteriol. 193 (1), 323-324 (2011) PUBMED 21037006.


DNA sequence :
ATGAGCAAAACAACCAAATACGGCATATACCTCACCAGCGCACTGATCGTCACCGCAGTAGGCGCCCCCCCGCTGCTGCT
AGTCCCTATCGCACTACTCGCACTACTGACTTGGAAGGAAAACAAATGA

Protein sequence :
MSKTTKYGIYLTSALIVTAVGAPPLLLVPIALLALLTWKENK