PAI Gene Information


Name : SAAV_0792 (SAAV_0792)
Accession : YP_003281715.1
PAI name : SaPIAv
PAI accession : NC_013450_P1
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : pathogenicity island protein
Function : -
Note : -
Homologs in the searched genomes :   19 hits    ( 19 protein-level )  
Publication :
    -Lowder,B.V., Guinane,C.M., Ben Zakour,N.L. and Fitzgerald,J.Ross., "Direct Submission", Submitted (30-SEP-2009) The Roslin Institute and Centre for Infectious Diseases, Royal (Dick) School of Veterinary Studies, University of Edinburgh, The Chancellor's Building, New Royal Infirmary, 49 Little France Crescent, Edinburgh EH16 4SB, Scotland, U.

    -Lowder,B.V., Guinane,C.M., Ben Zakour,N.L., Weinert,L.A., Conway-Morris,A., Cartwright,R.A., Simpson,A.J., Rambaut,A., Nubel,U. and Fitzgerald,J.R., "Recent human-to-poultry host jump, adaptation, and pandemic spread of Staphylococcus aureus", Proc. Natl. Acad. Sci. U.S.A. 106 (46), 19545-19550 (2009) PUBMED 19884497.

    -Lowder,B.V., Guinane,C.M., Ben Zakour,N.L., Weinert,L.A., Conway-Morris,A., Cartwright,R.A., Simpson,A.J., Rambaut,A., Nubel,U. and Fitzgerald,J.R., "Direct Submission", Submitted (29-OCT-2009) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence : 
ATGAAAATGTACTTAACTTATATTTGCTTAGTTTCATTGTTAACAATACTATTACTAGCAATATCTAACATGTATGTCGC
TTTTAGTGTGTACGGCATGATGGTAACTTATGGATTTAATTTAACAGGAGGATTAGAAAATGAATAA

Protein sequence : 
MKMYLTYICLVSLLTILLLAISNMYVAFSVYGMMVTYGFNLTGGLENE