PAI Gene Information


Name : SEQ_2040 (SEQ_2040)
Accession : YP_002747255.1
PAI name : phi_Seq4
PAI accession : NC_012471_P3
Strain : Streptococcus equi 4047
Virulence or Resistance: Not determined
Product : phage holin
Function : -
Note : -
Homologs in the searched genomes :   72 hits    ( 72 protein-level )  
Publication :
    -Holden,M.T., Heather,Z., Paillot,R., Steward,K.F., Webb,K., Ainslie,F., Jourdan,T., Bason,N.C., Holroyd,N.E., Mungall,K., Quail,M.A., Sanders,M., Simmonds,M., Willey,D., Brooks,K., Aanensen,D.M., Spratt,B.G., Jolley,K.A., Maiden,M.C., Kehoe,M., Chanter,N., "Genomic evidence for the evolution of Streptococcus equi: host restriction, increased virulence, and genetic exchange with human pathogens", PLoS Pathog. 5 (3), E1000346 (2009) PUBMED 19325880.

    -Holden,M.T.G., "Direct Submission", Submitted (08-AUG-2008) Holden M.T.G., Pathogen Sequencing Unit, The Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.

    -Holden,M.T.G., Mitchell,Z., Paillot,R., Steward,K., Webb,K., Ainslie,F., Maiden,M.C.J., Jolley,K.A., Robinson,C., Chanter,N., Kehoe,M., Maskell,D., Parkhill,J., Bentley,S.D. and Waller,A.S., "Evidence for the evolution of host-restriction in the genome of Streptococcus equi subsp. equi, the causative agent of strangles", Unpublished.

    -Holden,M.T.G., Mitchell,Z., Paillot,R., Steward,K., Webb,K., Ainslie,F., Maiden,M.C.J., Jolley,K.A., Robinson,C., Chanter,N., Kehoe,M., Maskell,D., Parkhill,J., Bentley,S.D. and Waller,A.S., "Direct Submission", Submitted (27-MAR-2009) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGATCAATTTAAAATTACGACTACAAAACAAAGTAACCTTGATGGCTATTTTAGGAGCTATCTTTTTACTGGCACAGCA
ATTAGGTATTAAACTACCATCAAACATCGCGGATATTGCAAACACAGCTGTAACGCTTTTGGTATTGCTCGGTGTTGTCA
CAGATCCAACCACGAAAGGCCTGTCAGACAGTGAGCAAGCTTTGACTTACCACGAACCAAAACAATAG

Protein sequence :
MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVTLLVLLGVVTDPTTKGLSDSEQALTYHEPKQ