PAI Gene Information


Name : YPO0338 (YPO0338)
Accession : YP_002345417.1
PAI name : Not named
PAI accession : NC_003143_P2
Strain : Yersinia pestis A1122
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : No significant database hits
Homologs in the searched genomes :   12 hits    ( 12 protein-level )  
Publication :
    -Delihas,N., "Annotation and evolutionary relationships of a small regulatory RNA gene micF and its target ompF in Yersinia species", BMC Microbiol. 3, 13 (2003) PUBMED 12834539 REMARK Publication Status: Online-Only.

    -Parkhill,J., "Direct Submission", Submitted (04-OCT-2001) Submitted on behalf of the Yersinia sequencing team, Sanger Centre, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail: parkhill@sanger.ac.uk REMARK Direct Submission.

    -Parkhill,J., Wren,B.W., Thomson,N.R., Titball,R.W., Holden,M.T., Prentice,M.B., Sebaihia,M., James,K.D., Churcher,C., Mungall,K.L., Baker,S., Basham,D., Bentley,S.D., Brooks,K., Cerdeno-Tarraga,A.M., Chillingworth,T., Cronin,A., Davies,R.M., Davis,P., Dou, "Genome sequence of Yersinia pestis, the causative agent of plague", Nature 413 (6855), 523-527 (2001) PUBMED 11586360.

    -Parkhill,J., Wren,B.W., Thomson,N.R., Titball,R.W., Holden,M.T., Prentice,M.B., Sebaihia,M., James,K.D., Churcher,C., Mungall,K.L., Baker,S., Basham,D., Bentley,S.D., Brooks,K., Cerdeno-Tarraga,A.M., Chillingworth,T., Cronin,A., Davies,R.M., Davis,P., Dou, "Direct Submission", Submitted (12-DEC-2008) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REMARK Direct Submission.

    -Rosso,M.L., Chauvaux,S., Dessein,R., Laurans,C., Frangeul,L., Lacroix,C., Schiavo,A., Dillies,M.A., Foulon,J., Coppee,J.Y., Medigue,C., Carniel,E., Simonet,M. and Marceau,M., "Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression", BMC Microbiol. 8, 211 (2008) PUBMED 19055764 REMARK Publication Status: Online-Only.


DNA sequence :
ATGGCTACGTTCAGTGATGGCAGTTTTTTTATTGACAACAAGACGCCTTATTTTAATTTGTTAATTATGGGTGAGGTATT
AATTATATATGAAGTGCTAGATATATTTCAAAATAATTTTTTATATGTAAATATCACTAATGAATTACATTGGGGCTTTA
ATCTATAA

Protein sequence :
MATFSDGSFFIDNKTPYFNLLIMGEVLIIYEVLDIFQNNFLYVNITNELHWGFNL