PAI Gene Information


Name : virB7-1 (HPP12_0465)
Accession : YP_002301101.1
PAI name : cag PAI
PAI accession : NC_011498_P1
Strain : Helicobacter pylori 2017
Virulence or Resistance: Virulence
Product : VirB7 type IV secretion protein
Function : -
Note : -
Homologs in the searched genomes :   30 hits    ( 30 protein-level )  
Publication :
    -Fischer,W., Windhager,L., Karnholz,A., Zeiller,M., Zimmer,R. and Haas,R., "Direct Submission", Submitted (22-OCT-2008) Max von Pettenkofer-Institut fuer Hygiene und Medizinische Mikrobiologie, Ludwig-Maximilians-Universitaet Muenchen, Pettenkoferstr. 9a, Munich 80336, Germany.

    -Fischer,W., Windhager,L., Rohrer,S., Zeiller,M., Karnholz,A., Hoffmann,R., Zimmer,R. and Haas,R., "Strain-specific genes of Helicobacter pylori: genome evolution driven by a novel type IV secretion system and genomic island transfer", Nucleic Acids Res. 38 (18), 6089-6101 (2010) PUBMED 20478826.

    -Fischer,W., Windhager,L., Rohrer,S., Zeiller,M., Karnholz,A., Hoffmann,R., Zimmer,R. and Haas,R., "Direct Submission", Submitted (30-OCT-2008) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGAGAATATTTTTAATAGGAATAATTTTGTTAGCACTAAGTGGATGTTCTAACAAACAATATGAAGTGTATAAAAGCCC
TTGTGCCTTTTTTCACTTAAATCAATCCATAGGCTAG

Protein sequence :
MRIFLIGIILLALSGCSNKQYEVYKSPCAFFHLNQSIG