PAI Gene Information


Name : rpmJ (cur_1485)
Accession : YP_001800879.1
PAI name : Not named
PAI accession : NC_010545_R1
Strain : Corynebacterium urealyticum DSM 7109
Virulence or Resistance: Not determined
Product : 50S ribosomal protein L36
Function : -
Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io
Homologs in the searched genomes :   850 hits    ( 850 protein-level )  
Publication :
    -Linke,B., "Direct Submission", Submitted (18-FEB-2008) Linke B., Center For Biotechnology, Bielefeld University, Universitaetsstrasse 25, 33501 Bielefeld, GERMANY.

    -Tauch,A., Trost,E., Tilker,A., Ludewig,U., Schneiker,S., Goesmann,A., Arnold,W., Bekel,T., Brinkrolf,K., Brune,I., Gotker,S., Kalinowski,J., Kamp,P.B., Lobo,F.P., Viehoever,P., Weisshaar,B., Soriano,F., Droge,M. and Puhler,A., "The lifestyle of Corynebacterium urealyticum derived from its complete genome sequence established by pyrosequencing", J. Biotechnol. 136 (1-2), 11-21 (2008) PUBMED 18367281.

    -Tauch,A., Trost,E., Tilker,A., Ludewig,U., Schneiker,S., Goesmann,A., Arnold,W., Bekel,T., Brinkrolf,K., Brune,I., Gotker,S., Kalinowski,J., Kamp,P.B., Lobo,F.P., Viehoever,P., Weisshaar,B., Soriano,F., Droge,M. and Puhler,A., "Direct Submission", Submitted (03-APR-2008) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGAAGGTCCGTAAGTCCCTTCGGTCGCTGAAGAACAAGCCGGGCGCTCAGGTTGTGCGTCGCCACGGTAAGGTCTACGT
CATCAACAAGAAGGATCCGCGTTTCAAGGCTCGCCAGGGCTAA

Protein sequence :
MKVRKSLRSLKNKPGAQVVRRHGKVYVINKKDPRFKARQG