PAI Gene Information


Name : NWMN_0414 (NWMN_0414)
Accession : YP_001331448.1
PAI name : vSa_alpha
PAI accession : NC_009641_P1
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : similar to functionally unknown protein
Homologs in the searched genomes :   71 hits    ( 71 protein-level )  
Publication :
    -Baba,T., Bae,T., Schneewind,O. and Hiramatsu,K., "Direct Submission", Submitted (15-FEB-2007) Tadashi Baba, Juntendo University School of Medicine, Department of Bacteriology; 2-1-1 Hongo, Bunkyo, Tokyo 113-8421, Japan (E-mail:tbaba@med.juntendo.ac.jp, Tel:81-3-5802-1041, Fax:81-3-5684-7830).

    -Baba,T., Bae,T., Schneewind,O., Takeuchi,F. and Hiramatsu,K., "Genome sequence of Staphylococcus aureus strain Newman and comparative analysis of staphylococcal genomes: polymorphism and evolution of two major pathogenicity islands", J. Bacteriol. 190 (1), 300-310 (2008) PUBMED 17951380.

    -Baba,T., Bae,T., Schneewind,O., Takeuchi,F. and Hiramatsu,K., "Direct Submission", Submitted (06-JUL-2007) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence : 
ATGA

Protein sequence : 
MMFNQINNKNELEESYESEKKRIENELQNLNELRHRTRKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEII
RKQEWKLEEYKEDLKKSYEKQLDKLSD