PAI Gene Information


Name : YE3459 (YE3459)
Accession : YP_001007621.1
PAI name : YAPI
PAI accession : NC_008800_P2
Strain : Yersinia enterocolitica 8081
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : Weakly similar to several proteins of undefined function including: Escherichia coli hypothetical protein YkfI or b0245 SWALL:YKFI_ECOLI (SWALL:P77692) (113 aa) fasta scores: E(): 2e-08, 38.2 38d in 89 aa, and to Escherichia coli SWALL:Q9XB43 (EMBL:D83536
Homologs in the searched genomes :   17 hits    ( 17 protein-level )  
Publication :
    -Delihas,N., "Annotation and evolutionary relationships of a small regulatory RNA gene micF and its target ompF in Yersinia species", BMC Microbiol. 3, 13 (2003) PUBMED 12834539 REMARK Publication Status: Online-Only.

    -Delihas,N., "Direct Submission", Submitted (19-JAN-2007) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Thomson,N.R., "Direct Submission", Submitted (30-JUN-2006) Thomson N.R., Pathogen Sequencing Unit, The Wellcome Trust Sanger Institute, Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.

    -Thomson,N.R., Howard,S., Wren,B.W., Holden,M.T., Crossman,L., Challis,G.L., Churcher,C., Mungall,K., Brooks,K., Chillingworth,T., Feltwell,T., Abdellah,Z., Hauser,H., Jagels,K., Maddison,M., Moule,S., Sanders,M., Whitehead,S., Quail,M.A., Dougan,G., Parkh, "The complete genome sequence and comparative genome analysis of the high pathogenicity Yersinia enterocolitica strain 8081", PLoS Genet. 2 (12), E206 (2006) PUBMED 17173484.


DNA sequence :
ATGAATCAGGAACAACAATTCTGGCAGTTAACGGCATCTGCACTGTTTAACAAACACTTCGGATTGACTCTGAACGATAC
CGATTTTTGTGAGGAAACCTGCGTAGTGGCGCTATACGAAACCGGCAAACGTCCGTTTGAGGCGATTAACGGTTTGGTGG
ATAAATACAACCTGGCTCGTTTGAATAACAATGCTTTTCAACCACGTTCACCTTACCTGAATGCAATCGATGAACTGATT
GTCGTTCTTGAAGCAGGCGCAACTTTAGACATTATCCGTCAACCATAA

Protein sequence :
MNQEQQFWQLTASALFNKHFGLTLNDTDFCEETCVVALYETGKRPFEAINGLVDKYNLARLNNNAFQPRSPYLNAIDELI
VVLEAGATLDIIRQP