PAI Gene Information


Name : HH0264 (HH0264)
Accession : NP_859795.1
PAI name : HHGI1
PAI accession : NC_004917_P1
Strain : Helicobacter hepaticus ATCC 51449
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Drescher,B. and Suerbaum,S., "Direct Submission", Submitted (27-MAY-2003) Institute of Hygiene and Microbiology, University of Wuerzburg, Josef Schneider Str. 2, Wuerzburg D-97080, Germany.

    -Suerbaum,S., Josenhans,C., Sterzenbach,T., Drescher,B., Brandt,P., Bell,M., Droge,M., Fartmann,B., Fischer,H.P., Ge,Z., Horster,A., Holland,R., Klein,K., Konig,J., Macko,L., Mendz,G.L., Nyakatura,G., Schauer,D.B., Shen,Z., Weber,J., Frosch,M. and Fox,J.G., "The complete genome sequence of the carcinogenic bacterium Helicobacter hepaticus", Proc. Natl. Acad. Sci. U.S.A. 100 (13), 7901-7906 (2003) PUBMED 12810954.

    -Suerbaum,S., Josenhans,C., Sterzenbach,T., Drescher,B., Brandt,P., Bell,M., Droge,M., Fartmann,B., Fischer,H.P., Ge,Z., Horster,A., Holland,R., Klein,K., Konig,J., Macko,L., Mendz,G.L., Nyakatura,G., Schauer,D.B., Shen,Z., Weber,J., Frosch,M. and Fox,J.G., "Direct Submission", Submitted (26-JUN-2003) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
TTGGTTTCTATTTCTGACATCTTACAATCCCCTCAATCTAAACAATATTATCTCTACAACCAAGATTATCAAGACTATCA
AATTTACTCCCTATGGATTAGACTTTAG

Protein sequence :
MVSISDILQSPQSKQYYLYNQDYQDYQIYSLWIRL