PAI Gene Information


Name : rpmG (EF0588)
Accession : NP_814353.1
PAI name : Not named
PAI accession : NC_004668_P1
Strain : Enterococcus faecalis D32
Virulence or Resistance: Not determined
Product : 50S ribosomal protein L33
Function : -
Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th
Homologs in the searched genomes :   1853 hits    ( 1853 protein-level )  
Publication :
    -Aakra,A., Vebo,H., Snipen,L., Hirt,H., Aastveit,A., Kapur,V., Dunny,G., Murray,B.E. and Nes,I.F., "Transcriptional response of Enterococcus faecalis V583 to erythromycin", Antimicrob. Agents Chemother. 49 (6), 2246-2259 (2005) PUBMED 15917518 REMARK Erratum:[Antimicrob Agents Chemother. 2005 Sep;49(9):3989. Murray, Barbara [corrected to Murray, Barbara E]].

    -Paulsen,I., Banerjei,L., Myers,G., Nelson,K., Seshadri,R., Read,T., Fouts,D., Eisen,J., Gill,S., Heidelberg,J., Tettelin,H., Dodson,R., Umayam,L., Brinkac,L., Beanan,M., Daugherty,S., DeBoy,R., Durkin,A., Kolonay,J., Madupu,R., Nelson,W., Vamathevan,J., T, "Direct Submission", Submitted (03-FEB-2003) The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD 20850, USA.

    -Paulsen,I., Banerjei,L., Myers,G.S.A., Nelson,K.E., Seshadri,R., Read,T.D., Fouts,D.E., Eisen,J.A., Gill,S.R., Heidelberg,J.F., Tettelin,H., Dodson,R.J., Umayam,L., Brinkac,L., Beanan,M., Daugherty,S., DeBoy,R.T., Durkin,S., Kolonay,J., Madupu,R., Nelson,, "Role of Mobile DNA in the Evolution of Vancomycin-Resistant Enterococcus faecalis", Science 299 (5615), 2071-2074 (2003) PUBMED 12663927.

    -Paulsen,I., Banerjei,L., Myers,G.S.A., Nelson,K.E., Seshadri,R., Read,T.D., Fouts,D.E., Eisen,J.A., Gill,S.R., Heidelberg,J.F., Tettelin,H., Dodson,R.J., Umayam,L., Brinkac,L., Beanan,M., Daugherty,S., DeBoy,R.T., Durkin,S., Kolonay,J., Madupu,R., Nelson,, "Direct Submission", Submitted (30-MAR-2003) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Wecker,P., Klockow,C., Ellrott,A., Quast,C., Langhammer,P., Harder,J. and Glockner,F.O., "Transcriptional response of the model planctomycete Rhodopirellula baltica SH1(T) to changing environmental conditions", BMC Genomics 10, 410 (2009) PUBMED 19725962 REMARK Publication Status: Online-Only.


DNA sequence :
ATGCGTCAAAATATTATTTTAGAATGTGTCGAAACTGGAGAACGTCTGTATCTCACTAGCAAAAATAAACGGAATAACCC
TGAACGGATAGAATTAAAAAAGTATTCTCCAAAATTGCGCAGACGGGCAATTTTCAAAGAAGTGAAATAG

Protein sequence :
MRQNIILECVETGERLYLTSKNKRNNPERIELKKYSPKLRRRAIFKEVK