PAI Gene Information


Name : PSPTO_1366 (PSPTO_1366)
Accession : NP_791193.1
PAI name : Hrp PAI
PAI accession : NC_004578_P1
Strain : Pseudomonas syringae 1448A
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   37 hits    ( 37 protein-level )  
Publication :
    -Buell,C.R., Joardar,V., Lindeberg,M., Selengut,J., Paulsen,I.T., Gwinn,M.L., Dodson,R.J., Deboy,R.T., Durkin,A.S., Kolonay,J.F., Madupu,R., Daugherty,S., Brinkac,L., Beanan,M.J., Haft,D.H., Nelson,W.C., Davidsen,T., Zafar,N., Zhou,L., Liu,J., Yuan,Q., Kho, "The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000", Proc. Natl. Acad. Sci. U.S.A. 100 (18), 10181-10186 (2003) PUBMED 12928499.

    -Buell,C.R., Joardar,V., Lindeberg,M., Selengut,J., Paulsen,I.T., Gwinn,M.L., Dodson,R.J., Deboy,R.T., Durkin,A.S., Kolonay,J.F., Madupu,R., Daugherty,S., Brinkac,L., Beanan,M.J., Haft,D.H., Nelson,W.C., Davidsen,T., Zafar,N., Zhou,L., Liu,J., Yuan,Q., Kho, "Direct Submission", Submitted (09-MAR-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Buell,R., Joardar,V., Khouri,H., Fedorova,N., Tran,B., Russell,D., Berry,K., Utterback,T., Van Aken,S., Feldblyum,T., Gwinn,M., Dodson,R., DeBoy,R., Durkin,A., Kolonay,J., Madupu,R., Daugherty,S., Brinkac,L., Beanan,M., Haft,D., Selengut,J., Nelson,W., Da, "Direct Submission", Submitted (03-MAR-2003) The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD 20850, USA.

    -Lindeberg,M., "Direct Submission", Submitted (08-MAR-2010) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Protein update by submitter.

    -Lindeberg,M., "Direct Submission", Submitted (19-DEC-2008) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Amino acid sequence update by submitter.

    -Lindeberg,M., "Direct Submission", Submitted (21-MAR-2008) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Amino acid sequence update by submitter.

    -Lindeberg,M., "Direct Submission", Submitted (27-NOV-2007) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Amino acid sequence update by submitter.

    -Lindeberg,M., "Direct Submission", Submitted (07-SEP-2007) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Amino acid sequence update by submitter.

    -Lindeberg,M., "Direct Submission", Submitted (14-DEC-2006) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Amino acid sequence updated by submitter.

    -Lindeberg,M., "Direct Submission", Submitted (22-NOV-2006) Dept of Plant Pathology, Plant Science Building, Cornell University, Ithaca, NY 14853, USA REMARK Amino acid sequence updated by submitter.


DNA sequence :
ATGAACCGTCGCAAGAAAATACAGCAACTGTTAAAGGCTCATGCCAAGAAAGCCAGCGCTAAACTGGCACCGGCAAACAA
ATCCAGCTACGTGAGCAAGGCTGATCGGTTGAAGCTGGCGGCAGAGTCCGGTAACGACCCGATCAGTTCCGTCGAGGACT
GA

Protein sequence :
MNRRKKIQQLLKAHAKKASAKLAPANKSSYVSKADRLKLAAESGNDPISSVED