PAI Gene Information


Name : trp1329A
Accession : CAB46577.1
PAI name : HPI
PAI accession : AJ132945
Strain : Yersinia enterocolitica 8081
Virulence or Resistance: Not determined
Product : IS1329 transposase A
Function : -
Note : -
Homologs in the searched genomes :   425 hits    ( 425 protein-level )  
Publication :
    -Carniel,E., Guilvout,I. and Prentice,M., "Characterization of a large chromosomal 'high-pathogenicity island' in biotype 1B Yersinia enterocolitica", J. Bacteriol. 178 (23), 6743-6751 (1996) PUBMED 8955291.

    -Rakin,A. and Heesemann,J., "Virulence-associated fyuA/irp2 gene cluster of Yersinia enterocolitica biotype 1B carries a novel insertion sequence IS1328", FEMS Microbiol. Lett. 129 (2-3), 287-292 (1995) PUBMED 7607411.

    -Rakin,A., Noelting,C., Schubert,S. and Heesemann,J., "Common and specific characteristics of the high-pathogenicity island of Yersinia enterocolitica", Infect. Immun. 67 (10), 5265-5274 (1999) PUBMED 10496905.

    -Rakin,A., Schubert,S., Guilvout,I., Carniel,E. and Heesemann,J., "Local hopping of IS3 elements into the A+T-rich part of the high-pathogenicity island in Yersinia enterocolitica 1B, O:8", FEMS Microbiol. Lett. 182 (2), 225-229 (2000) PUBMED 10620670.

    -Rakin,A.V., "Direct Submission", Submitted (15-FEB-1999) Rakin A.V., BAF, Max von Pettenkofer Institute, Pettenkofer Str.9a, Munich 80336, GERMANY.


DNA sequence : 
ATGAGCAACACTAACGAGGTGAGAATGCGAAAAAAATCATTTACTCATGAGTTTAAACAAGAGTGCGTCAACCTGGTTCT
TCAACATAAGTACCCGGTGACTCAGGCTGCTGAAACAATGAATATTGGCCTTTCAACCTTACAACGCTGGCTACGGCAGT
ATCGCGGAGAGAGCCGCGGAAATACACCGATAGCCAGTGCTATAACACCGGAACAACGCCGAATACAAGAACTTGAAAAG
CAGGTGCGGCAGTTACAGAGCGACAATGACCTGTTAAAAAAGGCTTCGGCCTTCTTCGCCATGGAAATGAACAACGACAA
AAAGTCGCGGTAA

Protein sequence : 
MSNTNEVRMRKKSFTHEFKQECVNLVLQHKYPVTQAAETMNIGLSTLQRWLRQYRGESRGNTPIASAITPEQRRIQELEK
QVRQLQSDNDLLKKASAFFAMEMNNDKKSR