PAI Gene Information


Name : unnamed
Accession : BAG06196.1
PAI name : Type-VII SCCmec
PAI accession : AB462393
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : ORF No.13
Homologs in the searched genomes :   18 hits    ( 17 protein-level,   1 DNA-level )  
Publication :
    -Higuchi,W., Takano,T., Teng,L.J. and Yamamoto,T., "Structure and specific detection of staphylococcal cassette chromosome mec type VII", Biochem. Biophys. Res. Commun. 377 (3), 752-756 (2008) PUBMED 18926798.

    -Takano,T., Higuchi,W., Otsuka,T., Baranovich,T., Enany,S., Saito,K., Isobe,H., Dohmae,S., Ozaki,K., Takano,M., Iwao,Y., Shibuya,M., Okubo,T., Yabe,S., Shi,D., Reva,I., Teng,L.J. and Yamamoto,T., "Novel characteristics of community-acquired methicillin-resistant Staphylococcus aureus strains belonging to multilocus sequence type 59 in Taiwan", Antimicrob. Agents Chemother. 52 (3), 837-845 (2008) PUBMED 18086843.

    -Yamamoto,T. and Higuchi,W., "Direct Submission", Submitted (28-SEP-2008) Contact:Tatsuo Yamamoto Niigata University Graduate School of Medical and Dental Sciences, Division of Bacteriology, Department of Infectious Disease Control and International Medicine; 757 Ichibanchou, Asahimachidori, Niigata, Nii.


DNA sequence :
ATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTT
CGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAG
AGAAATAA

Protein sequence :
MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK