PAI Gene Information


Name : unnamed
Accession : BAB47662.1
PAI name : Type-III SCCmec
PAI accession : AB037671
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : ORF No.CZ061
Homologs in the searched genomes :   6 hits    ( 6 protein-level )  
Publication :
    -Ito,T., Hiramatsu,K., Oonuki,Y. and Yajima,T., "Direct Submission", Submitted (29-JAN-2000) Contact:Teruyo Ito Juntendo University, Department of Bacteriology; Hongo 2-1-1, Bunkyo-ku, Tokyo 113-8421, Japan.

    -Ito,T., Katayama,Y., Asada,K., Mori,N., Tsutsumimoto,K., Tiensasitorn,C. and Hiramatsu,K., "Structural comparison of three types of staphylococcal cassette chromosome mec integrated in the chromosome in methicillin-resistant Staphylococcus aureus", Antimicrob. Agents Chemother. 45 (5), 1323-1336 (2001) PUBMED 11302791 REMARK Erratum:[Antimicrob Agents Chemother 2001 Dec;45(12):3677].

    -Ito,T., Okuma,K., Ma,X.X., Yuzawa,H. and Hiramatsu,K., "Insights on antibiotic resistance of Staphylococcus aureus from its whole genome: genomic island SCC", Drug Resist. Updat. 6 (1), 41-52 (2003) PUBMED 12654286.


DNA sequence : 
ATGCTTTTTAGAAGTAATAAAATTTTGCGTGTCTTTAGGGTTTTTCTGGTTCATTATAACCTTCTCCTTACTGGTTATAA
TGAACTGACATTAAGCGTTCATTATAACCAATTAATTTTGATTTGGTTGATAACTAACTTTATTAATAACAAATATAGAA
AAAGTACCCATACTTTTATCTCCTTTCCATTTTTTTCATTATGA

Protein sequence : 
MLFRSNKILRVFRVFLVHYNLLLTGYNELTLSVHYNQLILIWLITNFINNKYRKSTHTFISFPFFSL