PAI Gene Information


Name : aacC1/aacCA1
Accession : ACN81020.1
PAI name : AbaR5
PAI accession : FJ172370_R1
Strain : Acinetobacter baumannii 1656-2
Virulence or Resistance: Resistance
Product : aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia
Function : -
Note : confers resistance to gentamicin; contains a 23 aa N-terminal extension
Homologs in the searched genomes :   27 hits    ( 27 protein-level )  
Publication :
    -Hamidian,M., Hancock,D.P. and Hall,R.M., "Horizontal transfer of an ISAba125-activated ampC gene between Acinetobacter baumannii strains leading to cephalosporin resistance", J. Antimicrob. Chemother. 68 (1), 244-245 (2013) PUBMED 22915466.

    -Hamidian,M., Post,V. and Hall,R.M., "Direct Submission", Submitted (29-FEB-2012) Molecular and Microbial Biosciences, The University of Sydney, Biochemistry and Microbiology Building G08, Sydney, NSW 2061, Australia REMARK Sequence update by submitter.

    -Hamidian,M., Post,V., Kenyon,J.J., Holt,K.E., Pickard,D., Dougan,G. and Hall,R.M., "Direct Submission", Submitted (29-APR-2013) Molecular and Microbial Biosciences, The University of Sydney, Biochemistry and Microbiology Building G08, Sydney, NSW 2061, Australia REMARK Sequence update by submitter.

    -Kenyon,J.J. and Hall,R.M., "Variation in the Complex Carbohydrate Biosynthesis Loci of Acinetobacter baumannii Genomes", PLoS ONE 8 (4), E62160 (2013) PUBMED 23614028 REMARK Publication Status: Online-Only.

    -Kenyon,J.J., Holt,K.E., Pickard,D., Dougan,G. and Hall,R.M., "Direct Submission", Unpublished.

    -Post,V. and Hall,R.M., "AbaR5, a large multiple-antibiotic resistance region found in Acinetobacter baumannii", Antimicrob. Agents Chemother. 53 (6), 2667-2671 (2009) PUBMED 19364869.

    -Post,V. and Hall,R.M., "Direct Submission", Submitted (29-AUG-2008) Molecular and Microbial Biosciences, The University of Sydney, Biochemistry and Microbiology Building G08, Sydney, NSW 2061, Australia.

    -Post,V. and Hall,R.M., "Direct Submission", Submitted (23-APR-2009) Molecular and Microbial Biosciences, The University of Sydney, Biochemistry and Microbiology Building G08, Sydney, NSW 2061, Australia REMARK Sequence update by submitter.

    -Post,V. and Hall,R.M., "Direct Submission", Submitted (10-JUN-2009) Molecular and Microbial Biosciences, The University of Sydney, Biochemistry and Microbiology Building G08, Sydney, NSW 2061, Australia REMARK Sequence update by submitter.


DNA sequence :
ATGTTACGCAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGTGGCTCAAGTATGGGCATCAT
TCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGAGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGACG
TAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCT
GCCTTCGACCAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCAAAGTTTGAGCAGGCGCGTAGTGAGATCTA
TATCTATGATCTCGCAGTCTCCGGCGAGCACCGGAGGCAAGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGG
CCAACGCGCTTGGTGCTTATGTGATCTACGTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTG
GGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCAAGTACCGCCACCTAA

Protein sequence :
MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALA
AFDQEAVVGALAAYVLPKFEQARSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKL
GIREEVMHFDIDPSTAT