| Name : unnamed Accession : ACL99853.1
 PAI name :  Type-V SCCmec
 PAI accession : FJ544922
 Strain : Staphylococcus pseudintermedius ED99
 Virulence or Resistance: Resistance
 Product : truncated MecR1 protein
 Function : -
 Note : -
 Homologs in the searched genomes :    1 hits    ( 1 protein-level )
 Publication :
 
-Black,C.C., Solyman,S.M., Eberlein,L.C., Bemis,D.A., Woron,A.M. and Kania,S.A., "Identification of a predominant multilocus sequence type, pulsed-field gel electrophoresis cluster, and novel staphylococcal chromosomal cassette in clinical isolates of mecA-containing, methicillin-resistant Staphylococcus pseudintermedius", Vet. Microbiol. 139 (3-4), 333-338 (2009) PUBMED 19604657.
 -Kania,S.A., Eberlein,L.C. and Bemis,D.A., "Direct Submission", Submitted (11-DEC-2008) Comparative Medicine, University of Tennessee, 2407 River Dr., Knoxville, TN 37996, USA.
 
 
 
 
      | DNA sequence : |  |  | ATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATATACGGTTCT
GTTGCAAAGTTGA
 
 |  | Protein sequence : |  |  | MLSIISSLLTICVIFLVRMLYIKYTVLLQS
 
 |  |