PAI Gene Information


Name : unnamed
Accession : ACL99853.1
PAI name : Type-V SCCmec
PAI accession : FJ544922
Strain : Staphylococcus pseudintermedius ED99
Virulence or Resistance: Resistance
Product : truncated MecR1 protein
Function : -
Note : -
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Black,C.C., Solyman,S.M., Eberlein,L.C., Bemis,D.A., Woron,A.M. and Kania,S.A., "Identification of a predominant multilocus sequence type, pulsed-field gel electrophoresis cluster, and novel staphylococcal chromosomal cassette in clinical isolates of mecA-containing, methicillin-resistant Staphylococcus pseudintermedius", Vet. Microbiol. 139 (3-4), 333-338 (2009) PUBMED 19604657.

    -Kania,S.A., Eberlein,L.C. and Bemis,D.A., "Direct Submission", Submitted (11-DEC-2008) Comparative Medicine, University of Tennessee, 2407 River Dr., Knoxville, TN 37996, USA.


DNA sequence :
ATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATATACGGTTCT
GTTGCAAAGTTGA

Protein sequence :
MLSIISSLLTICVIFLVRMLYIKYTVLLQS