PAI Gene Information


Name : unnamed
Accession : ABR13509.1
PAI name : PAGI-6
PAI accession : EF611302
Strain : Pseudomonas aeruginosa B136-33
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   No hits  
Publication :
    -Battle,S.E., Meyer,F. and Hauser,A.R., "Direct Submission", Submitted (15-MAY-2007) Department of Microbiology/Immunology, Northwestern University Feinberg School of Medicine, 303 E. Chicago Ave, Chicago, IL 60611, USA.

    -Battle,S.E., Rello,J. and Hauser,A.R., "Genomic islands of Pseudomonas aeruginosa", FEMS Microbiol. Lett. 290 (1), 70-78 (2009) PUBMED 19025565.


DNA sequence :
ATGAGGGATCTTGAGATCGTCTTCTGGATCAACACTATTGAGGTCAACTCTTTCTTTGAACTTACCATCAAAATAACTAT
ATTTTGGAAAGCTCTCTAA

Protein sequence :
MRDLEIVFWINTIEVNSFFELTIKITIFWKAL