PAI Gene Information


Name : unnamed
Accession : ABR13445.1
PAI name : PAGI-5
PAI accession : EF611301
Strain : Pseudomonas aeruginosa B136-33
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   No hits  
Publication :
    -Battle,S.E., Meyer,F. and Hauser,A.R., "Genomic Islands of Pseudomonas aeruginosa", Unpublished.

    -Battle,S.E., Meyer,F. and Hauser,A.R., "Direct Submission", Submitted (15-MAY-2007) Department of Microbiology/Immunology, Northwestern University Feinberg School of Medicine, 303 E. Chicago Ave, Chicago, IL 60611, USA.

    -Battle,S.E., Meyer,F., Rello,J., Kung,V.L. and Hauser,A.R., "Hybrid pathogenicity island PAGI-5 contributes to the highly virulent phenotype of a Pseudomonas aeruginosa isolate in mammals", J. Bacteriol. 190 (21), 7130-7140 (2008) PUBMED 18757543.


DNA sequence :
ATGAGGCTGTCGCGCTTTCCCATCTCGACACTGCTGGATTCGGCCTCGGGACATCTCGAGGCCCATTTGTATAAGAAGCG
GCTTGCTGCCGAAAGCGGCGAACCGCTGGCTCAACAATATTCCGGCATCATTTTCAGCGGCAACCCGCATGAAAACCGTT
CCTCGGCGCCTGCTGCTGGATAA

Protein sequence :
MRLSRFPISTLLDSASGHLEAHLYKKRLAAESGEPLAQQYSGIIFSGNPHENRSSAPAAG