PAI Gene Information


Name : unnamed
Accession : AAZ31300.1
PAI name : ETT2
PAI accession : DQ077151
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : ORF2; similar to ECs3735 from Escherichia coli strain O157:H7 RIMD 0509952
Homologs in the searched genomes :   10 hits    ( 10 protein-level )  
Publication :
    -Ideses,D., Gophna,U., Chaudhuri,R.R., Pallen,M.J. and Ron,E.Z., "Direct Submission", Submitted (27-MAY-2005) Molecular Microbiology and Biotechnology, Tel Aviv University, Levanon, Tel Aviv, Ramat Aviv 69978, Israel.

    -Ideses,D., Gophna,U., Paitan,Y., Chaudhuri,R.R., Pallen,M.J. and Ron,E.Z., "A degenerate type III secretion system from septicemic Escherichia coli contributes to pathogenesis", J. Bacteriol. 187 (23), 8164-8171 (2005) PUBMED 16291689.


DNA sequence :
GTGATCAATAAATTACTGTTAGCTTACCTGATAGGTCTGGTTGTGACATCGACTTTTATATTTATCTTCTCGGAAGAAAA
AGTAACATATCGGTTGTTTGCTACAATAATTACAGGTTTAACCTGGCCGCTTAGTCTCATTCCTTCCATTATAAGTCTCA
TGATTCGTAAATCCGACTAA

Protein sequence :
MINKLLLAYLIGLVVTSTFIFIFSEEKVTYRLFATIITGLTWPLSLIPSIISLMIRKSD