PAI Gene Information


Name : uve2
Accession : AAQ84023.1
PAI name : Not named
PAI accession : AY322150
Strain : Enterococcus faecium Aus0004
Virulence or Resistance: Not determined
Product : Uve2-like
Function : -
Note : putative sigma factor; ORF1
Homologs in the searched genomes :   No hits  
Publication :
    -Leavis,H., Top,J., Shankar,N., Borgen,K., Bonten,M., van Embden,J. and Willems,R.J., "A novel putative enterococcal pathogenicity island linked to the esp virulence gene of Enterococcus faecium and associated with epidemicity", J. Bacteriol. 186 (3), 672-682 (2004) PUBMED 14729692.

    -Willems,R.J.L., Top,J., Borgen,K., Bonten,M.J.M. and van Embden,J.D.A., "Direct Submission", Submitted (12-JUN-2003) Diagnostic Laboratory for Infectious Diseases and Perinatal Screening, National Institute for Public Health and the Environment, Antonie van Leeuwenhoeklaan 9, Bilthoven 3720 MA, Netherlands.


DNA sequence : 
ATGTCAGATAACGACGAACGCGTAAATGCCCAGTTGATTCGATTCTTTGAAAAGGTCATTTTGAACACCGCTAATACTTA
TTATAAAAAACAAGAAGAAATTCAAAAACATGAACAACTTGATCA

Protein sequence : 
MSDNDERVNAQLIRFFEKVILNTANTYYKKQEEIQKHEQLD