PAI Gene Information


Name : unnamed
Accession : AAP70306.1
PAI name : HPI
PAI accession : AY233333
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : ORF7
Homologs in the searched genomes :   7 hits    ( 7 protein-level )  
Publication :
    -Schubert,S., Dufke,S., Sorsa,J. and Heesemann,J., "A novel integrative and conjugative element (ICE) of Escherichia coli: the putative progenitor of the Yersinia high-pathogenicity island", Mol. Microbiol. 51 (3), 837-848 (2004) PUBMED 14731283.

    -Schubert,S., Dufke,S., Sorsa,J. and Heesemann,J., "Direct Submission", Submitted (11-FEB-2003) Department of Bacteriology, Max von Pettenkofer-Institut, Pettenkoferstr. 9a, Munchen 80336, Germany.


DNA sequence : 
ATGAAACGCTTGATTGCGCTGGCTTTGCTGTGCGCGCTTTCTGGCTGCGCCCAGAACACGCCTCCCTCTGCCTTTAGCGG
TAAGGGAGAACCCGTAAACACCCCTCAAATTATGGCGGAGTTAAACAGTCATGAGTGA

Protein sequence : 
MKRLIALALLCALSGCAQNTPPSAFSGKGEPVNTPQIMAELNSHE