PAI Gene Information


Name : xopA
Accession : AAL78294.1
PAI name :
PAI accession : U33548
Strain :
Virulence or Resistance: Virulence
Product : XopA
Function : -
Note : Xanthomonas outer protein A; secreted by Xanthomonas type III pathway
Homologs in the searched genomes :   8 hits    ( 8 protein-level )  
Publication :
    -Bonas,U., "Direct Submission", Submitted (09-AUG-1995) Ulla Bonas, Institut des Sciences Vegetales, CNRS, Avenue de la Terrasse, Gif/Yvette, F 91198, France.

    -Fenselau,S. and Bonas,U., "Sequence and expression analysis of the hrpB pathogenicity operon of Xanthomonas campestris pv. vesicatoria which encodes eight proteins with similarity to components of the Hrp, Ysc, Spa, and Fli secretion systems", Mol. Plant Microbe Interact. 8 (6), 845-854 (1995) PUBMED 8664494.

    -Fenselau,S., Balbo,I. and Bonas,U., "Determinants of pathogenicity in Xanthomonas campestris pv. vesicatoria are related to proteins involved in secretion in bacterial pathogens of animals", Mol. Plant Microbe Interact. 5 (5), 390-396 (1992) PUBMED 1472717.

    -Noel,L., Thieme,F., Nennstiel,D. and Bonas,U., "Two novel type III-secreted proteins of Xanthomonas campestris pv. vesicatoria are encoded within the hrp pathogenicity island", J. Bacteriol. 184 (5), 1340-1348 (2002) PUBMED 11844763.

    -Noel,L., Thieme,F., Nennstiel,D. and Bonas,U., "Direct Submission", Submitted (06-AUG-2001) Institut fuer Genetik, Martin-Luther-Universitaet Halle-Wittenberg, Weinbergweg 10, Halle D-06099, Germany REMARK Sequence updated by submitter.

    -Wengelnik,K., Marie,C., Russel,M. and Bonas,U., "Expression and localization of HrpA1, a protein of Xanthomonas campestris pv. vesicatoria essential for pathogenicity and induction ofthe hypersensitive reaction", J. Bacteriol. 178 (4), 1061-1069 (1996) PUBMED 8576039.


DNA sequence :
ATGATCAATTCATTGAATACGTCGCACCTCGGCGTCGACTCTTCCTTTATGCAAGTCAACCCGGACCAATTTCAAAAATT
CGATTCAAATCAAAGCAATCAAGGCATCTCGGAAAAGCAGCTGGACCAACTGCTGACCCAGTTCATCTTTTCAATGCTTC
TGCAGGACGACAATGCTGATGATTCCCCGAACTCTGACAAGCCCACCGATTTTCCGTCGCCACGCACCCAGATGCTAATG
AATGTCATCGGAGACATTTTACAGGCGAAGAATGGCGGACGCCTCGGTGGTTTATCCGATGGAGGGCTCAACACTAGCCT
CAGCCTCTCGGGCGACACTGCATCGATGCAGTAA

Protein sequence :
MINSLNTSHLGVDSSFMQVNPDQFQKFDSNQSNQGISEKQLDQLLTQFIFSMLLQDDNADDSPNSDKPTDFPSPRTQMLM
NVIGDILQAKNGGRLGGLSDGGLNTSLSLSGDTASMQ