PAI Gene Information


Name : tnp
Accession : AAL78293.1
PAI name :
PAI accession : U33548
Strain :
Virulence or Resistance: Not determined
Product : putative truncated transposase
Function : -
Note : a longer putative transposase can be produced by frameshifting at the AAAAAAC site
Homologs in the searched genomes :   1492 hits    ( 1492 protein-level )  
Publication :
    -Bonas,U., "Direct Submission", Submitted (09-AUG-1995) Ulla Bonas, Institut des Sciences Vegetales, CNRS, Avenue de la Terrasse, Gif/Yvette, F 91198, France.

    -Fenselau,S. and Bonas,U., "Sequence and expression analysis of the hrpB pathogenicity operon of Xanthomonas campestris pv. vesicatoria which encodes eight proteins with similarity to components of the Hrp, Ysc, Spa, and Fli secretion systems", Mol. Plant Microbe Interact. 8 (6), 845-854 (1995) PUBMED 8664494.

    -Fenselau,S., Balbo,I. and Bonas,U., "Determinants of pathogenicity in Xanthomonas campestris pv. vesicatoria are related to proteins involved in secretion in bacterial pathogens of animals", Mol. Plant Microbe Interact. 5 (5), 390-396 (1992) PUBMED 1472717.

    -Noel,L., Thieme,F., Nennstiel,D. and Bonas,U., "Two novel type III-secreted proteins of Xanthomonas campestris pv. vesicatoria are encoded within the hrp pathogenicity island", J. Bacteriol. 184 (5), 1340-1348 (2002) PUBMED 11844763.

    -Noel,L., Thieme,F., Nennstiel,D. and Bonas,U., "Direct Submission", Submitted (06-AUG-2001) Institut fuer Genetik, Martin-Luther-Universitaet Halle-Wittenberg, Weinbergweg 10, Halle D-06099, Germany REMARK Sequence updated by submitter.

    -Wengelnik,K., Marie,C., Russel,M. and Bonas,U., "Expression and localization of HrpA1, a protein of Xanthomonas campestris pv. vesicatoria essential for pathogenicity and induction ofthe hypersensitive reaction", J. Bacteriol. 178 (4), 1061-1069 (1996) PUBMED 8576039.


DNA sequence :
ATGAAGAAGTCCCGTTTTACCGAAGAGCAGATCGCATACGCGCTCAAGCAGGTCGAGCTGGGGATGGCGGTTGGCGAGGT
GTGTCGCAAGATGGGCATTGCGGAGGCGACGTTCTATGTGTGGCGCAAGAAATACGGTGGGCTTGGACCCTCCGAACTGA
AGTGCCTGCGCGTGCTGGAAGAGGAAAACCGCAAGCTCAAGCAGCTGGTTGCCGACCTGAGCCTGGACAAGGCGATGCTC
CAGGAGGTGGTCACAAAAAAACTCTAA

Protein sequence :
MKKSRFTEEQIAYALKQVELGMAVGEVCRKMGIAEATFYVWRKKYGGLGPSELKCLRVLEEENRKLKQLVADLSLDKAML
QEVVTKKL