PAI Gene Information


Name : unnamed
Accession : AAL26666.1
PAI name : SCCcap1
PAI accession : U10927
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : ORF M19
Homologs in the searched genomes :   No hits  
Publication :
    -Lee,C.Y., "Direct Submission", Submitted (16-JUN-1994) Chia Y. Lee, Department of Microbiology, University of Kansas Medical Center, 3901 Rainbow Blvd., Kansas City, KS 66106, USA.

    -Lin,W.S., Cunneen,T. and Lee,C.Y., "Sequence analysis and molecular characterization of genes required for the biosynthesis of type 1 capsular polysaccharide in Staphylococcus aureus", J. Bacteriol. 176 (22), 7005-7016 (1994) PUBMED 7961465.

    -Luong,T.T., Ouyang,S., Bush,K. and Lee,C.Y., "Type 1 capsule genes of Staphylococcus aureus are carried in a staphylococcal cassette chromosome genetic element", J. Bacteriol. 184 (13), 3623-3629 (2002) PUBMED 12057957.

    -Luong,T.T., Shu,O., Bush,K. and Lee,C.Y., "Direct Submission", Submitted (01-NOV-2001) Department of Microbiology, University of Kansas Medical Center, 3901 Rainbow Blvd., Kansas City, KS 66106, USA REMARK Sequence update by submitter.


DNA sequence : 
ATGTCATATTTTACTCCCTTAACATACTTTCATATCGCTTCTTGCAGTGAATTAAGTTCTTTATTTAACATTTCATCATT
TCCACCAAATATACTTATCGCCATAGCTCCATACAACAACGATATCTATAATATTGTCATCAAAATAAATGTAGCAATCA
ATACAGCTATACGTTCTCATAATTTCACTACTTTTATAAATTTATGCAACAAATCACTTGTTTTCCGTTTAATATAA

Protein sequence : 
MSYFTPLTYFHIASCSELSSLFNISSFPPNILIAIAPYNNDIYNIVIKINVAINTAIRSHNFTTFINLCNKSLVFRLI