PAI Gene Information


Name : ORF3
Accession : AAK27330.1
PAI name : PAI-I AL862
PAI accession : AF286671
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : -
Homologs in the searched genomes :   No hits  
Publication :
    -Lalioui,L. and Le Bouguenec,C., "afa-8 Gene cluster is carried by a pathogenicity island inserted into the tRNA(Phe) of human and bovine pathogenic Escherichia coli isolates", Infect. Immun. 69 (2), 937-948 (2001) PUBMED 11159989.

    -Lalioui,L. and Le Bouguenec,C.C., "Direct Submission", Submitted (13-JUL-2000) Unite de Pathogenie Bacterienne des Muqueuses, Institut Pasteur, 28 rue du Dr Roux, Paris cedex 15 75724, France.


DNA sequence :
ATGGAAACGAAGCAAAAAGAGCGTATCCGACGTTTGATTGAAATACTTAAGAAAACCGACAGAATCCATTTGAAAGACGC
GGCACGAATGCTGGAAGTTTCTGTAATGACTATTCGTCGCGATCTCCATCAGGAAGATGAACCTCTGCCACTGACCCTAC
TGGGTGGCTATA

Protein sequence :
METKQKERIRRLIEILKKTDRIHLKDAARMLEVSVMTIRRDLHQEDEPLPLTLLGGY