PAI Gene Information


Name : qacEdelta1
Accession : AAK02047.1
PAI name : SGI1
PAI accession : AF261825
Strain : Salmonella enterica RSK2980
Virulence or Resistance: Not determined
Product : quaternary ammonium compound and disinfectant protein
Function : -
Note : -
Homologs in the searched genomes :   616 hits    ( 616 protein-level )  
Publication :
    -Boyd,D., Peters,G.A., Cloeckaert,A., Boumedine,K.S., Chaslus-Dancla,E., Imberechts,H. and Mulvey,M.R., "Complete nucleotide sequence of a 43-kilobase genomic island associated with the multidrug resistance region of Salmonella enterica serovar Typhimurium DT104 and its identification in phage type DT120 and serovar Agona", J. Bacteriol. 183 (19), 5725-5732 (2001) PUBMED 11544236.

    -Boyd,D.A., Peters,G.A., Ng,L. and Mulvey,M.R., "Partial characterization of a genomic island associated with the multidrug resistance region of Salmonella enterica Typhymurium DT104", FEMS Microbiol. Lett. 189 (2), 285-291 (2000) PUBMED 10930753.

    -Mulvey,M.R., Boyd,D.A. and Peters,G.A., "Direct Submission", Submitted (09-FEB-2001) National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Health Canada, 1015 Arlington Street, Winnipeg, Manitoba R3E 3R2, Canada REMARK Sequence update by submitter.

    -Mulvey,M.R., Boyd,D.A., Peters,G.A. and Ng,L.-K., "Direct Submission", Submitted (01-MAY-2000) Bureau of Microbiology, Laboratory of Centre for Disease Control, 1015 Arlington Street, Winnipeg, Manitoba R3E 3R2, Canada.


DNA sequence :
ATGAAAGGCTGGCTTTTTCTTGTTATCGCAATAGTTGGCGAAGTAATCGCAACATCCGCATTAAAATCTAGCGAGGGCTT
TACTAAGCTTGCCCCTTCCGCCGTTGTCATAATCGGTTATGGCATCGCATTTTATTTTCTTTCTCTGGTTCTGAAATCCA
TCCCTGTCGGTGTTGCTTATGCAGTCTGGTCGGGACTCGGCGTCGTCATAATTACAGCCATTGCCTGGTTGCTTCATGGG
CAAAAGCTTGATGCGTGGGGCTTTGTAGGTATGGGGCTCATAATTGCTGCCTTTTTGCTCGCCCGATCCCCATCGTGGAA
GTCGCTGCGGAGGCCGACGCCATGGTGA

Protein sequence :
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHG
QKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW