PAI Gene Information


Name : unnamed
Accession : AAK01538.1
PAI name : PAGI-1
PAI accession : AF241171
Strain : Pseudomonas aeruginosa B136-33
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   No hits  
Publication :
    -Liang,X. and Lory,S., "Direct Submission", Submitted (01-MAR-2000) Microbiology, University of Washington, Seattle, WA 98195, USA.

    -Liang,X., Pham,X.Q., Olson,M.V. and Lory,S., "Identification of a genomic island present in the majority of pathogenic isolates of Pseudomonas aeruginosa", J. Bacteriol. 183 (3), 843-853 (2001) PUBMED 11208781.


DNA sequence :
ATGGTTCCAAAGCCCAGACGCCGAACCTTCCTCCCGGCCAGCATGCCGTGCGATGAATACATCATGCTAACCCCAAGCGT
TGAAATACGTCGGCAGTGA

Protein sequence :
MVPKPRRRTFLPASMPCDEYIMLTPSVEIRRQ