PAI Gene Information


Name : afaD
Accession : AAD44023.1
PAI name : PAI-I AL862
PAI accession : AF072900
Strain : Escherichia coli 042
Virulence or Resistance: Virulence
Product : AfaD
Function : -
Note : -
Homologs in the searched genomes :   4 hits    ( 4 protein-level )  
Publication :
    -Lalioui,L. and Le Bouguenec,C., "afa-8 Gene cluster is carried by a pathogenicity island inserted into the tRNA(Phe) of human and bovine pathogenic Escherichia coli isolates", Infect. Immun. 69 (2), 937-948 (2001) PUBMED 11159989.

    -Lalioui,L. and Le Bouguenec,C., "Direct Submission", Submitted (19-JUN-1998) Path. Bact. des Muq., Institut Pasteur, 28 rue du Dr. Roux, Paris Cedex 15 75724, France.

    -Lalioui,L. and Le Bouguenec,C., "Direct Submission", Submitted (01-JUL-1998) Path. Bact. des Muq., Institut Pasteur, 28 rue du Dr Roux, Paris cedex 15 75724, France.

    -Lalioui,L. and Le Bouguenec,C., "Direct Submission", Submitted (03-AUG-1999) Path. Bact. des Muq., Institut Pasteur, 28 rue du Dr. Roux, Paris Cedex 15 75724, France REMARK Sequence update by submitter.

    -Lalioui,L. and Le Bouguenec,C.C., "Direct Submission", Submitted (02-AUG-2000) Unite de Pathogenie Bacterienne des Muqueuses, Institut Pasteur, 28 rue du Dr Roux, Paris Cedex 15 75724, France REMARK Sequence update by submitter.

    -Lalioui,L., Jouve,M., Gounon,P. and Le Bouguenec,C., "Molecular cloning and characterization of the afa-7 and afa-8 gene clusters encoding afimbrial adhesins in Escherichia coli strains associated with diarrhea or septicemia in calves", Infect. Immun. 67 (10), 5048-5059 (1999) PUBMED 10496877.


DNA sequence :
ATGAAGAAAATACAGATAGTATGTAGTGGTATTGTACTGGTGGTTATATCCAGTCTGGCGCAGGCAGTTGAACTGAGTCT
TAATACCAGTGATGGAAGGAGTGGCGAGTTAAAAGACGGTACGAAGGTGGCAACAGGAAGGATTATCTGCCGAGGCACCT
ATACAAGTTTTCATATCTGGATGAATAGCAGACAAATGGGAAATATTCCTGGTCACTATATTATACTGGGTAGACATGAC
AGTCATAATGAAATGCGGGTTAGGCTGGATGGCGCAGGATGGTTGCCATCGGTAAGTGATGGGCAAGGTATGGTCAGTAC
CGGGATACCTGAGCAGCATACATTTGATGTTGTGATTGACGGAAATCAGCTGCTTGGGCCTGATGAATATATATTATCAG
TTAGCGGAGAATGCTCATAA

Protein sequence :
MKKIQIVCSGIVLVVISSLAQAVELSLNTSDGRSGELKDGTKVATGRIICRGTYTSFHIWMNSRQMGNIPGHYIILGRHD
SHNEMRVRLDGAGWLPSVSDGQGMVSTGIPEQHTFDVVIDGNQLLGPDEYILSVSGECS