Name : hrpT
Accession : AAC35806.1
PAI name : Hrp PAI
PAI accession : AF069652
Strain : Pseudomonas syringae 1448A
Virulence or Resistance: Virulence
Product : putative outer membrane protein
Function : -
Note : HrpT
Homologs in the searched genomes : 8 hits ( 8 protein-level )
Publication :
-Deng,W.L., Preston,G., Collmer,A., Chang,C.J. and Huang,H.C., "Characterization of the hrpC and hrpRS operons of Pseudomonas syringae pathovars syringae, tomato, and glycinea and analysis of the ability of hrpF, hrpG, hrcC, hrpT, and hrpV mutants to elicit the hypersensitive response and disease in plants", J. Bacteriol. 180 (17), 4523-4531 (1998) PUBMED 9721291.
-Preston,G.M. and Collmer,A., "Direct Submission", Submitted (03-JUN-1998) Plant Sciences, University of Oxford, South Parks Road, Oxford OX1 3RB, UK.
DNA sequence : | |
ATGAAGATCAGTAGCATTGCAGTTGTGCTGGTGCTGTTCGCTACCCTGTCGGGGTGTGCCACCCATGGCTGTACGGGAGT
TGCCTGCAAACGTCCGGACTCCACAAACCGCGAACTGGTCATCTGGTGGCCGCCGGACATGCGCGACGGTCTGGACGACC
AGGACCACGAGCGGGATTACACAGTCGTGAAGTTAAAGGATTAG
|
Protein sequence : | |
MKISSIAVVLVLFATLSGCATHGCTGVACKRPDSTNRELVIWWPPDMRDGLDDQDHERDYTVVKLKD
|
|