PAI Gene Information


Name : hrpT
Accession : AAC35755.1
PAI name : Hrp PAI
PAI accession : AF051694
Strain : Pseudomonas syringae 1448A
Virulence or Resistance: Virulence
Product : putative lipoprotein
Function : -
Note : HrpT; fourth gene of hrpC operon
Homologs in the searched genomes :   7 hits    ( 7 protein-level )  
Publication :
    -Deng,W.-L., Preston,G., Collmer,A., Chang,C.-J. and Huang,H.-C., "Direct Submission", Submitted (27-FEB-1998) Plant Pathology, Cornell University, 334, Plant Science Bldg, Ithaca, NY 14853, USA.

    -Deng,W.L., Preston,G., Collmer,A., Chang,C.J. and Huang,H.C., "Characterization of the hrpC and hrpRS operons of Pseudomonas syringae pathovars syringae, tomato, and glycinea and analysis of the ability of hrpF, hrpG, hrcC, hrpT, and hrpV mutants to elicit the hypersensitive response and disease in plants", J. Bacteriol. 180 (17), 4523-4531 (1998) PUBMED 9721291.


DNA sequence : 
ATGAAGATCAGCAGCGTTGCAGTCGTGTTGGTGGTGTTCGCTACCCTGACCGGGTGCGCCACCCACGGTTGTTCGGGAAC
TGCCTGCAAACGCCCGGACTCCACCAGCCGCGAACTGGTCATCTGGTGGCCTCCGGACATGCGTGACGGTCTTGACGACC
AGGACCACGAGCGTGATTACACCGTCGTGAAGTTAAGGGACTAG

Protein sequence : 
MKISSVAVVLVVFATLTGCATHGCSGTACKRPDSTSRELVIWWPPDMRDGLDDQDHERDYTVVKLRD