PAI Gene Information


Name : unnamed
Accession : AAC28957.2
PAI name : SaPI1
PAI accession : U93688
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : -
Function : -
Note : orf6
Homologs in the searched genomes :   18 hits    ( 18 protein-level )  
Publication :
    -Barry,P.C. and Novick,R.P., "Direct Submission", Submitted (23-JAN-2002) Molecular Pathogenesis, Skirball Institute of Biomolecular Medicine, NYU Medical Center, 540 First Avenue, New York, NY 10016, USA REMARK Sequence update by submitter.

    -Lindsay,J.A., Kreiswirth,B.N. and Novick,R.P., "Direct Submission", Submitted (15-MAR-1997) Molecular Pathogenesis, Skirball Institute of Biomolecular Medicine, NYU Medical Center, 540 First Avenue, New York, NY 10016, USA.

    -Lindsay,J.A., Ruzin,A., Ross,H.F., Kurepina,N. and Novick,R.P., "The gene for toxic shock toxin is carried by a family of mobile pathogenicity islands in Staphylococcus aureus", Mol. Microbiol. 29 (2), 527-543 (1998) PUBMED 9720870.


DNA sequence : 
ATGGAAACAAAATACGAGTTAAATAATACTAAAAAGGTCGCAAATGCATTTGGTTTAAATGAAGAAGATACAAATCTATT
AATAAATGCAGTTGATTTGGATATTAAAAACAATATGCAGGAGATTTCAAGTGAGTTACAACAATCAGAACAGTCTAAGC
AAAAGCAATATGGTACAACGCTACAAAATTTAGCTAAGCAAAACAGGATTATTAAATAG

Protein sequence : 
METKYELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSELQQSEQSKQKQYGTTLQNLAKQNRIIK