PAI Gene Information


Name : hrpD
Accession : AAB05081.1
PAI name : Hrp PAI
PAI accession : EF514224
Strain : Pseudomonas syringae 1448A
Virulence or Resistance: Virulence
Product : HrpD
Function : -
Note : -
Homologs in the searched genomes :   4 hits    ( 4 protein-level )  
Publication :
    -Alfano,J.R. and Collmer,A., "Direct Submission", Submitted (07-FEB-2000) Dept. Biol. Sci., UNLV, 1854 Maryland Parkway, Las Vegas, NV 89154, USA.

    -Alfano,J.R., Charkowski,A.O., Deng,W.L., Badel,J.L., Petnicki-Ocwieja,T., van Dijk,K. and Collmer,A., "The Pseudomonas syringae Hrp pathogenicity island has a tripartite mosaic structure composed of a cluster of type III secretion genes bounded by exchangeable effector and conserved effector loci that contribute to parasitic fitness and pathogenicity in pl", Proc. Natl. Acad. Sci. U.S.A. 97 (9), 4856-4861 (2000) PUBMED 10781092.

    -Huang,H.-C., "Direct Submission", Submitted (26-APR-1995) Hsiou-Chen Huang, Agricultural Biotechnology Laboratories, National Chung Hsing University, Taichung 40227, Taiwan.

    -Huang,H.C., Lin,R.H., Chang,C.J., Collmer,A. and Deng,W.L., "The complete hrp gene cluster of Pseudomonas syringae pv. syringae 61 includes two blocks of genes required for harpinPss secretion that are arranged colinearly with Yersinia ysc homologs", Mol. Plant Microbe Interact. 8 (5), 733-746 (1995) PUBMED 7579617.

    -Ramos,A.R., Morello,J.E., Ravindran,S., Deng,W.-L., Huang,H.-C. and Collmer,A., "Direct Submission", Submitted (21-MAR-2007) Plant Pathology, Cornell University, 334 Plant Science Building, Ithaca, NY 14853, USA.

    -Ramos,A.R., Morello,J.E., Ravindran,S., Deng,W.L., Huang,H.C. and Collmer,A., "Identification of Pseudomonas syringae pv. syringae 61 type III secretion system Hrp proteins that can travel the type III pathway and contribute to the translocation of effector proteins into plant cells", J. Bacteriol. 189 (15), 5773-5778 (2007) PUBMED 17526708.

    -Yu,C.-C. and Huang,H.-C., "The sequence analysis of conserved effector locus of the Pseudomonas syringae pv. syringae 61", Unpublished.

    -Yu,C.-C. and Huang,H.-C., "Direct Submission", Submitted (04-APR-2003) Graduate Institute of Biotechnology, National Chung-Hsing University, Taichung 40227, Taiwan.


DNA sequence :
ATGGTCAGCCGTCACAGTGTGTTCCTGCAGAGTATCGGCATCACGCCAAGTCAACCGCCAATGCCTGCGGAGCCTGTTTT
GAACTGGCTGGCACTGACGCCCGTGCAGCGTGATCAGGCGCTGGATCTGGCGCAGCGCATCTGTTTTTCCCGTAACGAAA
GCGACGGCCATGACGGGCAGTGGTGCTGGGCGCTGACCAAAGCGTTGCGCCCCGGTGTCTGGCTGGAGCTGGAGCGTGAA
GATGCGCGCTTGCTGTTGGGTGCCTGGCTCGGGCCTGAGTATTGGTCGCGATTGCGTCTGGCCTGGGCGCCCGATGAGGT
CACCGACAGACCTTGCGCGGCCCCCGAAAATAAACTTCAGACGTTGTGGCAGGCTGTTCTATGGCGTGTCACCGCGACCT
GA

Protein sequence :
MVSRHSVFLQSIGITPSQPPMPAEPVLNWLALTPVQRDQALDLAQRICFSRNESDGHDGQWCWALTKALRPGVWLELERE
DARLLLGAWLGPEYWSRLRLAWAPDEVTDRPCAAPENKLQTLWQAVLWRVTAT