PAI Gene Information


Name : acfD
Accession : AAA82710.1
PAI name : VPI
PAI accession : U39068
Strain : Vibrio cholerae IEC224
Virulence or Resistance: Virulence
Product : AcfD
Function : -
Note : accessory colonization factor
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Everiss,K.D., Hughes,K.J. and Peterson,K.M., "The accessory colonization factor and toxin-coregulated pilus gene clusters are physically linked on the Vibrio cholerae 0395 chromosome", DNA Seq. 5 (1), 51-55 (1994) PUBMED 7894059.

    -Everiss,K.D., Hughes,K.J., Kovach,M.E. and Peterson,K.M., "The Vibrio cholerae acfB colonization determinant encodes an inner membrane protein that is related to a family of signal-transducing proteins", Infect. Immun. 62 (8), 3289-3298 (1994) PUBMED 8039900.

    -Hughes,K.J., Everiss,K.D., Kovach,M.E. and Peterson,K.M., "Isolation and characterization of the Vibrio cholerae acfA gene, required for efficient intestinal colonization", Gene 156 (1), 59-61 (1995) PUBMED 7737517.

    -Hughes,K.J., Everiss,K.D., Kovach,M.E. and Peterson,K.M., "Sequence analysis of the Vibrio cholerae acfD gene reveals the presence of an overlapping reading frame, orfZ, which encodes a protein that shares sequence similarity to the FliA and FliC products of Salmonella", Gene 146 (1), 79-82 (1994) PUBMED 8063108.

    -Kovach,M.E., "Identification and characterization of a Vibrio cholerae pathogenicity island that encodes environmentally regulated colonization determinants", Thesis (1995).

    -Kovach,M.E., Hughes,K.J., Everiss,K.D. and Peterson,K.M., "Identification of a ToxR-activated gene, tagE, that lies within the accessory colonization factor gene cluster of Vibrio cholerae O395", Gene 148 (1), 91-95 (1994) PUBMED 7523253.

    -Kovach,M.E., Hughes,K.J., Harkey,C.W., Everiss,K.D., Shaffer,M.D. and Peterson,K.M., "Direct Submission", Submitted (22-OCT-1995) Michael E. Kovach, Microbiology and Immunology, LSUMC-Shreveport, 1501 Kings Highway, Shreveport, LA 71130, USA.


DNA sequence :
ATGAAGATTCGTATTGTATCATTGATAGTTTTGGGTTTTCTTATAGGTTGTAAGCATGAAAGTATAATTACCCCTACTGT
GCCTGCTGATGGTTCGGGTGGTAACGCACTAAATCCTGGTTTGGTAGGTGGTTATTTGCCAGATATTGGTGTTCCGGATC
CCATTATCTCGCTATCCATGACTTTAGATGGTAACTTGAAATTTGATAGTTCTTTACTGTGTAATGATCAAGATGCCTCT
CATATTTCAAATATCACAAAAAGATAA

Protein sequence :
MKIRIVSLIVLGFLIGCKHESIITPTVPADGSGGNALNPGLVGGYLPDIGVPDPIISLSMTLDGNLKFDSSLLCNDQDAS
HISNITKR