Gene Information

Name : CPE3_0899 (CPE3_0899)
Accession : YP_008584030.1
Strain : Chlamydia pecorum P787
Genome accession: NC_022441
Putative virulence/resistance : Virulence
Product : type III secretion system protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1028950 - 1029234 bp
Length : 285 bp
Strand : +
Note : -

DNA sequence :
GTGTTAACTCTTGCTACAAGCTTCAAATCTATCCTGTTTGAATACTCGTACCAATCTCTCCTACTGATTCTTATTGTTTC
AGCCCCTCCGATCATCCTTGCTTCCATCGTAGGGATTATGGTGGCGATTTTTCAGGCCGCAACGCAAATCCAAGAGCAAA
CATTTGCTTTTGCCATTAAGCTTGTTGTTATTTTTGGAACTCTGATGATCTCTGGAGGGTGGCTCAGTACGATGATCCTA
CGCTTCGCAAGTCAGATCTTCCAAAACTTTTATAAATGGAAATAA

Protein sequence :
MLTLATSFKSILFEYSYQSLLLILIVSAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTLMISGGWLSTMIL
RFASQIFQNFYKWK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 9e-11 46
ssaS YP_216428.1 secretion system apparatus protein SsaS Virulence SPI-2 Protein 3e-05 45
ssaS NP_460385.1 type III secretion system apparatus protein Virulence SPI-2 Protein 3e-05 45
ssaS CAA68200.1 secretion system apparatus, SsaS Virulence SPI-2 Protein 2e-05 45
ssaS NP_456108.1 putative type III secretion protein Virulence SPI-2 Protein 3e-05 45
ssaS NP_805091.1 type III secretion protein Virulence SPI-2 Protein 3e-05 45
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 9e-12 45
escS AAK26701.1 EscS Virulence LEE Protein 5e-09 44
escS AAL57528.1 EscS Virulence LEE Protein 5e-09 44
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 8e-09 44
escS CAC81848.1 EscS protein Virulence LEE II Protein 5e-09 44
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 8e-09 44
unnamed AAL06355.1 EscS Virulence LEE Protein 4e-09 43
escS CAI43888.1 EscS protein Virulence LEE Protein 1e-08 43
lscS AAO18039.1 LscS Virulence TTSS locus Protein 3e-10 42
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 3e-08 42
escS NP_290282.1 hypothetical protein Virulence LEE Protein 3e-08 42
escS AAC38370.1 EscS Virulence LEE Protein 2e-08 42
ECs4582 NP_312609.1 EscS Virulence LEE Protein 3e-08 42
escS AAC31527.1 L0048 Virulence LEE Protein 2e-08 42
escS ACU09472.1 hypothetical protein Not tested LEE Protein 2e-08 42
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 1e-08 41
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 1e-08 41
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 1e-08 41
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 1e-08 41
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 5e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CPE3_0899 YP_008584030.1 type III secretion system protein VFG2132 Protein 1e-36 91
CPE3_0899 YP_008584030.1 type III secretion system protein VFG0520 Protein 7e-06 45
CPE3_0899 YP_008584030.1 type III secretion system protein VFG0043 Protein 4e-12 42
CPE3_0899 YP_008584030.1 type III secretion system protein VFG0187 Protein 3e-07 42
CPE3_0899 YP_008584030.1 type III secretion system protein VFG0826 Protein 8e-09 42
CPE3_0899 YP_008584030.1 type III secretion system protein VFG0716 Protein 8e-09 42
CPE3_0899 YP_008584030.1 type III secretion system protein VFG1772 Protein 4e-13 41
CPE3_0899 YP_008584030.1 type III secretion system protein VFG0550 Protein 3e-09 41