Gene Information

Name : ompR (SCD_n01835)
Accession : YP_008546678.1
Strain : Sulfuricella denitrificans skB26
Genome accession: NC_022357
Putative virulence/resistance : Virulence
Product : osmolarity response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1857248 - 1857967 bp
Length : 720 bp
Strand : +
Note : K07659

DNA sequence :
ATGACTTCTGCTGCCCGCATTCTTCTCATCGACGACGACGCCCGCATCCGCGAACTGTTGTTGCGCTACCTCACCGAACA
GGGTTTCGATGTTAAGGCCGCGGCCGATGGTCGGGAAATGGCCCAACTGCTCGATCGCGGCCGCTTCGACGTGTGGGTAC
TGGACCTCATGCTGCCGGGCGAGGATGGTCTGTCCATCCTGCGCCGCGCCCGCGGCACCGGCGAAAACACACCGGTGATC
CTGCTCACCGCCAAGGGTGACGAAATCGACCGCATCGTCGGGCTGGAAATGGGCGCCGATGATTATCTGGCCAAGCCGTT
CAACCCGCGCGAACTGGTGGCGCGCATCAATGCCATCCTGCGTCGTCAGCGCATTGCGCTGCCGGGCGCACCGGATTCAT
CGGCGGGCACGGTCAACTTCGGCTCCTGCCACCTCGATCTCGGCACCCGCACACTGACCCGTGACGGCAAATCAGTATCG
CTCACCACCGGCGAATTTTCGCTGCTGAAAGTGCTGGTCAACCACCCGCGCCAGCCACTTTCCCGCGACCGGTTGATGGA
ACTGGCACGGGGACGCGACCACGAAGCCTTCGACCGGACCATCGACGTGCAGATATCGCGCCTGCGCAAGCAGGTCGAAC
CCGATGCCGCTAAACCTCGCTACATCCAGACGGTATGGGGCCACGGCTACGTGTTTGTGCCGGACGACGGCGAAACATGA

Protein sequence :
MTSAARILLIDDDARIRELLLRYLTEQGFDVKAAADGREMAQLLDRGRFDVWVLDLMLPGEDGLSILRRARGTGENTPVI
LLTAKGDEIDRIVGLEMGADDYLAKPFNPRELVARINAILRRQRIALPGAPDSSAGTVNFGSCHLDLGTRTLTRDGKSVS
LTTGEFSLLKVLVNHPRQPLSRDRLMELARGRDHEAFDRTIDVQISRLRKQVEPDAAKPRYIQTVWGHGYVFVPDDGET

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ompR YP_008546678.1 osmolarity response regulator CP000034.1.gene3671. Protein 4e-74 61
ompR YP_008546678.1 osmolarity response regulator NC_008702.1.4607594. Protein 1e-49 49
ompR YP_008546678.1 osmolarity response regulator CP000675.2.gene1535. Protein 2e-40 45
ompR YP_008546678.1 osmolarity response regulator CP001918.1.gene5135. Protein 7e-29 44
ompR YP_008546678.1 osmolarity response regulator CP001138.1.gene4273. Protein 2e-31 42
ompR YP_008546678.1 osmolarity response regulator NC_002695.1.915041.p Protein 5e-31 42
ompR YP_008546678.1 osmolarity response regulator BAC0533 Protein 2e-31 42
ompR YP_008546678.1 osmolarity response regulator CP000034.1.gene3834. Protein 5e-31 42
ompR YP_008546678.1 osmolarity response regulator CP000647.1.gene4257. Protein 2e-31 42
ompR YP_008546678.1 osmolarity response regulator CP001485.1.gene721.p Protein 6e-33 41
ompR YP_008546678.1 osmolarity response regulator CP004022.1.gene3215. Protein 2e-33 41
ompR YP_008546678.1 osmolarity response regulator AE000516.2.gene3505. Protein 5e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ompR YP_008546678.1 osmolarity response regulator VFG1563 Protein 2e-38 41
ompR YP_008546678.1 osmolarity response regulator VFG1702 Protein 2e-38 41
ompR YP_008546678.1 osmolarity response regulator VFG1390 Protein 8e-35 41
ompR YP_008546678.1 osmolarity response regulator VFG1389 Protein 7e-27 41