Gene Information

Name : Ser39006_3574 (Ser39006_3574)
Accession : YP_008523956.1
Strain : Serratia sp. ATCC 39006
Genome accession: NC_022268
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4008824 - 4009549 bp
Length : 726 bp
Strand : +
Note : KEGG: DNA-binding transcriptional regulator BaeR; PFAM: response regulator receiver, transcriptional regulator domain-containing protein; SMART: response regulator receiver, transcriptional regulator domain-containing protein

DNA sequence :
ATGACAACCACCGAGTTTTCAAGTACCGAAACGCTGCCTGTCTTGATCGTTGAAGACGAGCCCAAGCTGGGACAATTGCT
GGTCGATTACCTTCAGGCCGCGGGTTACCAAACACACTGGCTCATCAATGGTAATGACGTACAACCCTGGGTAAAACAGC
ATCCTGCCTCGCTGATACTGCTTGATCTGATGCTGCCCGGCTGTGACGGTTTGAGCATTTGCCGCGACATTCGGCAATTT
TCCAATATCCCGATTATTATGGTCACCGCCCGAACGGAGGAGATAGACCGCCTGCTGGGACTGGAGATCGGCGCAGATGA
CTACATCTGCAAACCGTTCAGCCCACGAGAAGTGGTCGTGCGGGTCAAAACACTGCTGCGCCGTTGCCGCTGGCAAAACG
AACCGCTTCCAGAAGGAGAGAAGCCTCACTTACTGATTGATAAGCGCCGCCATCAGGCCAGTTATCTCGGACGCCATCTG
GATCTCACCCCGGCGGAGTTCCGTCTGCTGGAGACGCTCTCTGCCGAACCGGGTAAAGTGTTCTCCCGCGAACAGTTGCT
GGATAACCTTTATGATGACTACCGGGTGGTAACTGACCGGACCATTGACAGCCACATCAAAAATCTACGGCGTAAGCTGG
AACAACTCGATCAGGAAACCTCTTTCATTCGCACGGTATACGGCATCGGTTATCGCTGGGAAGCCGCCATCGGCCAGGAA
ACGTAA

Protein sequence :
MTTTEFSSTETLPVLIVEDEPKLGQLLVDYLQAAGYQTHWLINGNDVQPWVKQHPASLILLDLMLPGCDGLSICRDIRQF
SNIPIIMVTARTEEIDRLLGLEIGADDYICKPFSPREVVVRVKTLLRRCRWQNEPLPEGEKPHLLIDKRRHQASYLGRHL
DLTPAEFRLLETLSAEPGKVFSREQLLDNLYDDYRVVTDRTIDSHIKNLRRKLEQLDQETSFIRTVYGIGYRWEAAIGQE
T

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 4e-77 71
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family BAC0596 Protein 6e-77 71
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family BAC0039 Protein 4e-77 71
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-76 71
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 6e-77 71
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 4e-76 70
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 6e-77 70
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 6e-75 64
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 6e-48 50
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 6e-48 50
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 6e-48 50
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-36 42
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-36 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 2e-32 41
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ser39006_3574 YP_008523956.1 two component transcriptional regulator, winged helix family VFG1702 Protein 9e-28 41