Name : Ser39006_2920 (Ser39006_2920) Accession : YP_008523302.1 Strain : Serratia sp. ATCC 39006 Genome accession: NC_022268 Putative virulence/resistance : Virulence Product : type III secretion protein, HrpO family Function : - COG functional category : - COG ID : - EC number : - Position : 3215846 - 3216106 bp Length : 261 bp Strand : + Note : KEGG: hrcS, type III secretion system protein; TIGRFAM: type III secretion protein, HrpO family; PFAM: export protein FliQ family 3 DNA sequence : GTGGAAACACTCAATCTGTTCAAACAAGCCATGGTTCTGGTGGTGATGCTCTCGGCCCCCCCCTTGCTGGCAGCGGTAAT GGTCGGGGTACTGGTATCGCTGATACAGGCCGTCATGCAGCTTCAGGATCAGACGCTACCCTTTGCCGTCAAACTGGTTT CTGTCGGGTTGGTATTGGCGATGACCGGGCGCTGGATTGGCAGCGAGCTGATTCAACTGGCCGTCACGGCTTTCAGCATG ATTGAACATACCCACGTATGA Protein sequence : METLNLFKQAMVLVVMLSAPPLLAAVMVGVLVSLIQAVMQLQDQTLPFAVKLVSVGLVLAMTGRWIGSELIQLAVTAFSM IEHTHV |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 1e-25 | 76 |
hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 1e-25 | 76 |
hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 1e-25 | 76 |
hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 3e-26 | 75 |
hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 1e-24 | 72 |
hrcS | ABQ88360.1 | HrcS | Virulence | Hrp PAI | Protein | 2e-19 | 66 |
hrpO | AAB05076.1 | HrpO | Virulence | Hrp PAI | Protein | 2e-19 | 66 |
hrcS | AAT96147.1 | HrcS | Virulence | T-PAI | Protein | 9e-23 | 66 |
hrcS | AAT96201.1 | HrcS | Virulence | T-PAI | Protein | 9e-23 | 66 |
hrcS | NP_791221.1 | type III secretion protein HrcS | Virulence | Hrp PAI | Protein | 3e-22 | 64 |
hrcS | AAG33885.1 | HrcS | Virulence | Hrp PAI | Protein | 2e-22 | 64 |
spaQ | AAS66866.1 | SpaQ | Not tested | SSR-2 | Protein | 6e-12 | 48 |
lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 8e-11 | 47 |
ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 4e-08 | 44 |
escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 4e-10 | 44 |
escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 4e-10 | 44 |
spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 4e-09 | 44 |
spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 4e-09 | 44 |
spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 4e-09 | 44 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 4e-09 | 44 |
escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 2e-10 | 42 |
escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 2e-10 | 42 |
escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 2e-10 | 42 |
unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 2e-10 | 42 |
escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-10 | 42 |
escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-10 | 42 |
ECs3724 | NP_311751.1 | EpaQ | Not tested | LIM | Protein | 2e-10 | 42 |
epaQ | AAZ31292.1 | EpaQ | Virulence | ETT2 | Protein | 1e-10 | 42 |
escS | ACU09472.1 | hypothetical protein | Not tested | LEE | Protein | 3e-10 | 41 |
escS | YP_003236102.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 4e-10 | 41 |
escS | NP_290282.1 | hypothetical protein | Virulence | LEE | Protein | 4e-10 | 41 |
ECs4582 | NP_312609.1 | EscS | Virulence | LEE | Protein | 4e-10 | 41 |
escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 4e-10 | 41 |
escS | AAC38370.1 | EscS | Virulence | LEE | Protein | 3e-10 | 41 |
escS | AAC31527.1 | L0048 | Virulence | LEE | Protein | 3e-10 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG0187 | Protein | 1e-06 | 48 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG0395 | Protein | 2e-10 | 48 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG1772 | Protein | 5e-10 | 47 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG0550 | Protein | 1e-09 | 44 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG0043 | Protein | 4e-12 | 43 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG2454 | Protein | 1e-06 | 42 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG0826 | Protein | 1e-10 | 41 |
Ser39006_2920 | YP_008523302.1 | type III secretion protein, HrpO family | VFG0716 | Protein | 1e-10 | 41 |