Gene Information

Name : Ser39006_1425 (Ser39006_1425)
Accession : YP_008521807.1
Strain : Serratia sp. ATCC 39006
Genome accession: NC_022268
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1592078 - 1592749 bp
Length : 672 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver, transcriptional regulator domain-containing protein; KEGG: winged helix family two component transcriptional regulator; SMART: response regulator receiver, transcriptional regulat

DNA sequence :
ATGCGTATATTGATAGTCGAAGATGATCACAGCACCGGAGAATATTTGCGCAAAGGACTGGGTGAGGCGGGTTATGGTGT
GGATTTGGCTCGCAACGGTACCGACGGACTGTTTATGGCGCTGGAACAAACCTATGATCTGATCGTACTGGACGTCATGT
TGCCCGGGCTGGACGGCTGGCAACTCATAGAAATTATCCGTAAAAAAAACGATGTGCCGGTATTATTTCTAACCGCCCGC
GACGGGGTGCAGGATAGGATCCATGGTCTCGAATTAGGCGCGGATGACTATTTGATAAAGCCCTTTTCATTTACCGAGTT
GGTATTGCGTATCCGGACCCTGCTCCGGCGCGGCGTCACCCGCGAAGAGAATGACTATTGGTTGGCGGATCTGCATCTCG
ATGTATTACGGCGTAAAGTAACCCGGCGAGATCTGGCGGTTGTGCTAACTAACAAAGAGTTTGCCCTGCTCGCGCTATTT
GTTCAGCGCCAGGGTGAGGTTTTATCCCGTACCCAGATAGCGTCTCAAGTGTGGGATATGAATTTTGACAGTGATACCAA
CGTGGTTGACGTCGCGGTTAAACGCTTACGCGCTAAAATAGACCGTCCGTTTGAATTAAAATTGATCCATACAGTACGCG
GTATCGGTTATGTCTGCGAGCCTCGGCAATGA

Protein sequence :
MRILIVEDDHSTGEYLRKGLGEAGYGVDLARNGTDGLFMALEQTYDLIVLDVMLPGLDGWQLIEIIRKKNDVPVLFLTAR
DGVQDRIHGLELGADDYLIKPFSFTELVLRIRTLLRRGVTREENDYWLADLHLDVLRRKVTRRDLAVVLTNKEFALLALF
VQRQGEVLSRTQIASQVWDMNFDSDTNVVDVAVKRLRAKIDRPFELKLIHTVRGIGYVCEPRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-54 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-53 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 2e-64 63
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 4e-65 62
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 3e-60 61
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 5e-61 59
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-55 59
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-61 59
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-53 55
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family Y16952.3.orf35.gene. Protein 1e-22 42
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-37 41
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 2e-54 55
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 1e-33 45
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-40 44
Ser39006_1425 YP_008521807.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 1e-33 43