
|
Name : Ser39006_1276 (Ser39006_1276) Accession : YP_008521658.1 Strain : Serratia sp. ATCC 39006 Genome accession: NC_022268 Putative virulence/resistance : Virulence Product : phage transcriptional regulator, AlpA Function : - COG functional category : - COG ID : - EC number : - Position : 1417376 - 1417576 bp Length : 201 bp Strand : + Note : PFAM: Prophage CP4-57 regulatory; KEGG: AlpA family phage transcriptional regulator DNA sequence : ATGACAGCAAGAAGACTTATTCGCCTACCGGAAGTGATGAATAAAACGGGATATAGCAAAGCATGGATTTATCGACTTAT CAGCAGGGGCGATTTCCCAGAGCCGATTAAGATTGGAATAAGAGCCAGCGCTTTTGTTGAAAGTGAAATCGATGAATGGA TTGAAAATATTATTCAGTTATCACGTAAACATGCAGCGTAA Protein sequence : MTARRLIRLPEVMNKTGYSKAWIYRLISRGDFPEPIKIGIRASAFVESEIDEWIENIIQLSRKHAA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-08 | 50 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-08 | 50 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-08 | 50 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 7e-06 | 49 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 5e-06 | 49 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 4e-05 | 47 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 2e-07 | 47 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-07 | 44 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-07 | 44 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 6e-07 | 44 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 8e-06 | 43 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-05 | 43 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Ser39006_1276 | YP_008521658.1 | phage transcriptional regulator, AlpA | VFG1118 | Protein | 2e-08 | 50 |
| Ser39006_1276 | YP_008521658.1 | phage transcriptional regulator, AlpA | VFG1141 | Protein | 6e-08 | 44 |
| Ser39006_1276 | YP_008521658.1 | phage transcriptional regulator, AlpA | VFG1480 | Protein | 3e-06 | 43 |