Gene Information

Name : VAPA_1c36810 (VAPA_1c36810)
Accession : YP_008517436.1
Strain :
Genome accession: NC_022247
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3893160 - 3893633 bp
Length : 474 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATCGGAGAACTGGCCAAGGTCGCGAACACGCCGGTCGAAACCATCCGGTACTACGAGCGCGAGCAGCTGCTGCC
CGCGCCCGCGCGCACCGAAGGCAACTACCGCATCTACGACGACGAGCATGCGCAGCGCCTGGGCTTCATCCGCCGCTGCC
GTTCGCTGGACATGACGCTCGATGAGATTCGCAGTCTGCTGCGGTTTCGTGATGCGCCGGGAGAAGACTGCGGCGAAGTC
AACCAGCTGCTCGACGACCACATCGGCCACGTGGCCGCGCGCATCTCCGAACTCAAGACGCTGGAGAAGCAGCTGAAGGC
GCTGCGCCAGCAATGCTGCGGCCCCGAATCGGCGCGGAACTGCGGCATCCTGCAGGGGCTGGACACAGCTGCGCTCGCGA
CCGAACCCTTCGGGCAGCACGCGGGGCATGTACATGGGTCGCTGCACAACGCATCCGCGAAACGTTCGGCTTGA

Protein sequence :
MKIGELAKVANTPVETIRYYEREQLLPAPARTEGNYRIYDDEHAQRLGFIRRCRSLDMTLDEIRSLLRFRDAPGEDCGEV
NQLLDDHIGHVAARISELKTLEKQLKALRQQCCGPESARNCGILQGLDTAALATEPFGQHAGHVHGSLHNASAKRSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-35 56
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 6e-35 48
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 4e-35 48
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-34 48
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-34 48
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-34 48
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-34 48
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 4e-35 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VAPA_1c36810 YP_008517436.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 3e-36 60
VAPA_1c36810 YP_008517436.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 6e-41 58
VAPA_1c36810 YP_008517436.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0462 Protein 2e-26 41