Gene Information

Name : VAPA_2c09490 (VAPA_2c09490)
Accession : YP_008493965.1
Strain :
Genome accession: NC_022234
Putative virulence/resistance : Unknown
Product : putative transposase, IS66 family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 970755 - 971102 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
GTGATCGGCCTGCCCACGAGCACCCGCGTCTGGATCGTCGCGGGCCACACCGACATGAGGAAGGGATTCAACGGCCTGTC
AGCGATGGTGCAGACGGCGCTGGAGGCCAACCCCTTCTGCGGCCACGTCTTCGTCTTCCGCGGCCGGCGCGGCGACATGC
TGAAGGTCCTATGGTTCGATGGCCAGGGCCTGCTGATCCTGGCCAAGCGTTTGGAGCGAGGCCGCTTCGTCTGGCCGCAG
GCTGTGTCGGGCAAGGTCTCGCTGACCCCGGCGCAGTTGTCCATGCTGCTCGAAGGCATCGACTGGCGCATGCCGACGCG
CACCGATCAGCCCGTGCTCGCGGCTTGA

Protein sequence :
MIGLPTSTRVWIVAGHTDMRKGFNGLSAMVQTALEANPFCGHVFVFRGRRGDMLKVLWFDGQGLLILAKRLERGRFVWPQ
AVSGKVSLTPAQLSMLLEGIDWRMPTRTDQPVLAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-31 67
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-32 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-30 67
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-31 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-31 67
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-31 67
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-31 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-31 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-31 67
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-31 67
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-32 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-30 67
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-33 66
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-33 66
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-30 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-24 65
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-31 65
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-34 63
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-34 63
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-34 62
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-31 57
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-31 57
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-29 56
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-29 56
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-30 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG1709 Protein 6e-32 67
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG0792 Protein 6e-32 67
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG1698 Protein 2e-32 67
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG1517 Protein 8e-25 65
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG1052 Protein 1e-31 65
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG1665 Protein 2e-34 62
VAPA_2c09490 YP_008493965.1 putative transposase, IS66 family VFG1737 Protein 3e-31 55